Recombinant Aspergillus clavatus High osmolarity signaling protein sho1 (sho1)

Shipped with Ice Packs
In Stock

Description

Functional Significance in Fungal Biology

While specific research on A. clavatus Sho1 is limited, studies on closely related Aspergillus species, particularly A. fumigatus, provide valuable insights into the functional significance of this protein family. The Sho1 protein serves as an important adaptor element in the HOG-MAPK signaling pathway, which is crucial for fungal adaptation to various environmental stresses .

Role in Stress Response Mechanisms

In the model organism Saccharomyces cerevisiae, Sho1 forms one of the two upstream branches of the HOG-MAPK pathway, which is primarily involved in adaptation to stress conditions . Studies in A. fumigatus have demonstrated that this function is conserved, with Sho1 playing a significant role in regulating cellular responses to oxidative stress in particular . The conservation of this stress response mechanism across diverse fungal species suggests that A. clavatus Sho1 likely performs similar functions.

Research has shown that Sho1 is particularly important for adaptation to oxidative stress in A. fumigatus, with mutants lacking this protein displaying increased sensitivity to hydrogen peroxide (2.5 mM) and menadione (15 μM) . This finding indicates that Sho1 contributes significantly to the fungal defense against reactive oxygen species, which are commonly encountered during host invasion and in environmental niches.

Influence on Growth and Morphology

Beyond its role in stress adaptation, Sho1 also impacts fundamental aspects of fungal growth and development. Studies with A. fumigatus sho1 deletion mutants revealed significant alterations in growth rate, germination timing, and hyphal morphology . These mutants exhibited reduced growth rates, delayed germination of conidia, and irregular hyphal structures characterized by decreased production of phialides and conidia . These observations suggest that Sho1 regulates critical aspects of the fungal life cycle and morphogenesis.

The HOG-MAPK Signaling Pathway in Aspergillus

The High-Osmolarity-Glycerol Mitogen-Activated Protein Kinase (HOG-MAPK) pathway represents a conserved signaling cascade that enables fungi to respond to various environmental stresses. In S. cerevisiae, this pathway is activated in response to hyperosmotic conditions and involves a series of phosphorylation events culminating in the activation of the Hog1 MAPK . In Aspergillus species, homologs of the HOG pathway components have been identified and characterized, revealing both conserved and divergent features.

Components and Organization

In A. fumigatus, MpkC and SakA serve as homologs of the S. cerevisiae Hog1 and play crucial roles in adaptations to various stresses, including oxidative and osmotic challenges, heat shock, cell wall damage, and interactions with host immune cells . These components contribute significantly to the fungal virulence and pathogenicity.

Sho1 functions as an adaptor protein within this pathway, facilitating signal transduction from the cell membrane to downstream kinase cascades. In S. cerevisiae, Ste20p (a serine/threonine kinase) is necessary for osmotic stress response via the Sho1p branch of the HOG pathway . Similarly, research has identified PakA as a component of the SakA/MpkC MAPK pathway in A. fumigatus, contributing to cell wall stress responses and virulence .

Protein Interactions and Signaling Dynamics

Research utilizing protein pull-down experiments and mass spectrometry analysis has identified numerous proteins that interact with components of the HOG pathway under various stress conditions. In A. fumigatus, under osmotic stress induced by sorbitol, 118 and 213 proteins were detected as potential interactors of SakA and MpkC, respectively . Under cell wall stress caused by congo red, 420 and 299 proteins were detected interacting with SakA and MpkC, respectively . Interestingly, a subset of proteins (78 and 256) were common to both interactome analyses, suggesting shared response mechanisms to different types of stress .

The following table summarizes the key protein interactions observed in the HOG-MAPK pathway under different stress conditions:

Stress ConditionSakA InteractorsMpkC InteractorsCommon Interactors
Osmotic (Sorbitol)11821378
Cell Wall (Congo Red)420299256

These findings highlight the complexity and integration of stress response mechanisms in Aspergillus species, with Sho1 serving as a critical component of this sophisticated signaling network.

Comparative Analysis with Other Fungal Species

The Sho1 protein is highly conserved among fungi, suggesting its fundamental importance in fungal biology . Comparative studies between Aspergillus species and S. cerevisiae have revealed both shared and distinct features of Sho1 function, providing insights into the evolution of stress response mechanisms in fungi.

Conservation of Sho1 Function

Research has demonstrated that the role of Sho1 in adaptation to oxidative stress is similar between A. fumigatus and S. cerevisiae, indicating functional conservation across evolutionarily distant fungal species . This conservation extends to the broader HOG pathway, with homologs of key components identified in various fungal pathogens, including different Aspergillus species.

While A. fumigatus sho1 mutants displayed altered growth and morphology, they maintained virulence in an immunosuppressed mouse model, appearing as virulent as wild-type or complemented strains . This finding suggests that while Sho1 contributes to certain aspects of fungal biology, its loss can be compensated by alternative mechanisms during host invasion, highlighting the redundancy and robustness of fungal pathogenicity factors.

Laboratory Applications and Research Significance

The availability of Recombinant A. clavatus High osmolarity signaling protein Sho1 provides researchers with a valuable tool for investigating fungal stress response mechanisms, developing diagnostic techniques, and exploring potential therapeutic targets for fungal infections.

Experimental Applications

The recombinant protein can be utilized in various experimental contexts, including:

  1. Protein-Protein Interaction Studies: Identifying binding partners and signaling complexes that interact with Sho1 under different conditions.

  2. Structural Analyses: Determining the three-dimensional structure of Sho1 and its conformational changes during activation.

  3. Antibody Development: Generating specific antibodies for detection and localization of Sho1 in fungal cells.

  4. Inhibitor Screening: Testing potential inhibitors that might disrupt Sho1 function and thereby compromise fungal stress adaptation.

For laboratory applications, the recombinant protein should be stored at -20°C, with extended storage at -20°C or -80°C . Repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week to maintain protein integrity .

Clinical and Therapeutic Implications

Aspergillus species, particularly A. fumigatus, represent significant opportunistic fungal pathogens that cause serious, life-threatening infections in immunosuppressed patients . The increasing prevalence of invasive aspergillosis, coupled with limited treatment options and growing antifungal resistance, underscores the need for novel therapeutic approaches.

Understanding the function of Sho1 and its role in stress adaptation provides insights into potential vulnerabilities that could be exploited for antifungal therapy. While A. fumigatus sho1 mutants retained virulence in animal models, the protein's contribution to oxidative stress resistance and normal growth suggests that it might serve as part of a multi-target approach to antifungal development.

Future Research Directions

Despite significant advances in understanding the role of Sho1 in fungal biology, several important questions remain unanswered, particularly regarding the specific functions of A. clavatus Sho1. Future research directions might include:

  1. Comparative Functional Studies: Directly comparing the functions of Sho1 proteins from different Aspergillus species to identify conserved and divergent features.

  2. Structural Characterization: Determining the three-dimensional structure of A. clavatus Sho1 to inform structure-based drug design.

  3. Transcriptional Regulation: Investigating the factors that regulate sho1 expression under different environmental conditions.

  4. Interactome Mapping: Comprehensively identifying the proteins that interact with Sho1 in A. clavatus and comparing these interactions with those observed in other fungal species.

  5. Therapeutic Targeting: Exploring the potential of Sho1 as a target for novel antifungal agents, particularly in combination with other stress response components.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
sho1; ACLA_012130; High osmolarity signaling protein sho1; Osmosensor sho1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-292
Protein Length
full length protein
Species
Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
Target Names
sho1
Target Protein Sequence
MARFRASNILGDPFALATISIAILAWIIAFISSIIANIKMADYPNHAWWAIAYMFCCTIG VTVVVGSDTGLVYGVAVVGYLSAGLVLTSLSVNTLVYKGNSSAQAAAAGFILLSMIIIVW IFYFGSTPQATHRGFIDSFALNKEGGNAYGNGRPISTAFGHRPETTSTSAPQMYTSAQLN GFETSSPISGYPGGAPGSENRSSSQPRFGNPSASNLPANNNGQSQDEVPQPTEYPYRAKA IYSYDANPEDANEISFSKHEILEVSDVSGRWWQARKSSGETGIAPSNYLILL
Uniprot No.

Target Background

Function
Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of Sho1 protein in Aspergillus species?

The Sho1 protein is a membrane-bound adaptor protein that functions as a sensor in the HOG-MAPK signaling pathway. In Aspergillus species, Sho1p contains four putative transmembrane domains (typically amino acids 36-58, 68-87, 92-114, and 124-146) near its N-terminus, a linker domain between these regions, and an SH3 domain at the C-terminus (approximately amino acids 255-311) . The SH3 domain is believed to interact with the Pbs2p MAPK kinase, facilitating downstream signaling .

Functionally, Sho1 regulates hyphal growth, morphology, and adaptation to various stresses, particularly oxidative stress. In A. fumigatus, deletion of the sho1 gene results in reduced growth and germination rates, irregular hyphal morphology, decreased production of phialides and conidia, and increased sensitivity to oxidative stressors such as hydrogen peroxide and menadione .

How conserved is the Sho1 protein sequence across Aspergillus species?

Sequence analysis reveals high conservation of the Sho1 protein among Aspergillus species. The A. clavatus Sho1 protein shows 83% identity with that of A. fumigatus, while A. nidulans Sho1 shows 71% identity with A. fumigatus Sho1 . This high level of conservation suggests the functional importance of this protein in the Aspergillus genus. The sequence conservation is highest in the transmembrane regions, indicating the critical nature of membrane localization for proper Sho1 function .

When compared to more distant fungi, A. fumigatus Sho1 shares approximately 71% identity with Saccharomyces cerevisiae Sho1, suggesting broad conservation of this signaling protein across fungal kingdoms .

What role does Sho1 play in stress response pathways in Aspergillus?

Sho1 serves as a key sensor in the HOG-MAPK pathway, which is involved in adaptation to various stresses. In A. fumigatus, Sho1 is particularly important for adaptation to oxidative stress, as demonstrated by the increased sensitivity of sho1 deletion mutants to hydrogen peroxide (2.5 mM) and menadione (15 μM) .

While in S. cerevisiae Sho1 plays significant roles in both hyperosmotic stress adaptation and hydrogen peroxide resistance, in A. fumigatus, the contribution to oxidative stress adaptation appears more prominent . This parallels findings in Candida albicans, where Sho1p is important for growth under oxidative stress conditions and mediates phosphorylation of the Cek1 MAPK in exponentially growing cells .

How does the functional role of Sho1 differ between A. clavatus and other Aspergillus species?

In A. fumigatus, Sho1 regulates growth, morphology, and oxidative stress adaptation, but appears less critical for virulence in immunosuppressed mouse models . This contrasts with the role of Sho1 in C. albicans, where it links oxidative stress to morphogenesis and cell wall biosynthesis . For A. clavatus specifically, researchers should investigate whether its Sho1 protein shows functional specialization related to the ecological niche and metabolic requirements of this species.

What are the protein-protein interaction networks involving Sho1 in the HOG-MAPK pathway?

The Sho1 protein in Aspergillus species likely interacts with multiple components of the HOG-MAPK pathway. Based on knowledge from S. cerevisiae, the SH3 domain at the C-terminus of Sho1p interacts with the Pbs2p MAPK kinase . Through Ste11p, Sho1p activates the Pbs2p and Hog1p pathway to regulate glycerol synthesis and other adaptive responses .

For A. clavatus specifically, protein-protein interaction studies would need to identify whether interactions with pathway components are conserved. Researchers should employ techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity-dependent biotin labeling to map the interaction network of Sho1 in this species.

How does Sho1 influence morphological development in Aspergillus species?

In A. fumigatus, sho1 deletion results in irregular hyphal morphology characterized by reduced production of phialides and conidia . The mutant strain also shows reduced growth and germination rates compared to wild-type . This suggests that Sho1 is involved in signaling pathways that regulate normal morphological development and asexual reproduction in Aspergillus.

The mechanism by which Sho1 influences morphogenesis might involve cross-talk between the HOG-MAPK pathway and other signaling cascades that regulate hyphal growth and conidiation. For A. clavatus, researchers should investigate whether Sho1 deletion produces similar morphological effects and examine the molecular mechanisms linking Sho1 signaling to the expression of genes involved in cell wall formation, hyphal extension, and conidiophore development.

What are optimal methods for generating and validating sho1 deletion mutants in Aspergillus species?

Based on successful approaches with A. fumigatus, researchers can employ Agrobacterium tumefaciens-mediated transformation to create sho1 deletion mutants in A. clavatus. The following protocol outlines a methodical approach:

  • Design primers to amplify regions upstream and downstream of the sho1 gene

  • Create a deletion construct by replacing the sho1 coding region with a selectable marker (e.g., pyrG)

  • Transform the construct into A. tumefaciens

  • Co-culture A. tumefaciens with Aspergillus at 24°C for 48 hours

  • Transfer to selective media at 37°C for 48 hours

  • Isolate single colonies and confirm deletion through PCR screening

Validation of mutants should include:

  • PCR amplification of the deleted region (should be absent in mutants)

  • PCR amplification of junction regions to confirm homologous recombination

  • Southern blot analysis using a labeled sho1 probe

  • Complementation with the wild-type gene to restore phenotype

What expression systems are most effective for producing recombinant A. clavatus Sho1 protein?

For expressing recombinant A. clavatus Sho1 protein, researchers can consider several expression systems:

Bacterial Expression System (E. coli):

  • Advantages: High yield, straightforward protocols, cost-effective

  • Challenges: Potential misfolding of eukaryotic proteins, lack of post-translational modifications

  • Recommended for: Expression of soluble domains (e.g., the SH3 domain)

Yeast Expression System (S. cerevisiae or P. pastoris):

  • Advantages: Eukaryotic folding machinery, some post-translational modifications

  • Recommended for: Full-length protein with transmembrane domains

Homologous Expression (Aspergillus species):

  • Advantages: Native folding and processing, authentic post-translational modifications

  • Recommended for: Functional studies requiring native protein conformation

For the full-length A. clavatus Sho1 protein with its four transmembrane domains, a eukaryotic expression system would be preferable. Consider adding purification tags (e.g., His-tag, FLAG-tag) that can be removed after purification if they might interfere with protein function.

What assays can effectively evaluate Sho1's role in oxidative stress response?

To assess Sho1's role in oxidative stress response, researchers can implement the following assays:

Growth Inhibition Assays:

  • Plate wild-type, sho1 deletion mutant, and complemented strains on media containing various concentrations of oxidative stressors:

    • Hydrogen peroxide (1-5 mM)

    • Menadione (5-20 μM)

    • Diamide (0.5-2 mM)

  • Measure colony diameter at regular intervals to quantify growth inhibition

  • Calculate IC50 values for each strain and stressor

Cellular ROS Detection:

  • Treat fungal cells with oxidative stressors

  • Incubate with ROS-sensitive fluorescent dyes (e.g., DCFH-DA, DHE)

  • Measure fluorescence using flow cytometry or fluorescence microscopy

  • Compare ROS levels between wild-type and mutant strains

Antioxidant Enzyme Activity:

  • Extract proteins from wild-type and sho1 mutant strains

  • Measure activities of antioxidant enzymes (catalase, superoxide dismutase, glutathione peroxidase)

  • Compare basal and stress-induced enzyme activities

How should researchers interpret growth phenotypes of sho1 mutants in Aspergillus species?

When analyzing growth phenotypes of sho1 mutants in Aspergillus species, researchers should consider:

Quantitative Growth Analysis:

  • Measure colony diameter at regular intervals (24, 48, 72, 96 hours)

  • Calculate growth rate as mm/hour during linear growth phase

  • Compare growth rates using appropriate statistical tests (e.g., Student's t-test, ANOVA)

  • Present data as growth curves with error bars representing standard deviation from at least three biological replicates

Germination Analysis:

  • Count percentage of germinated conidia at regular intervals

  • Calculate time to 50% germination (GT50)

  • Compare GT50 values between wild-type and mutant strains

Interpretation Framework:

ParameterWild-typesho1 MutantPotential Interpretation
Growth rateNormalReducedSho1 required for normal growth signaling
GerminationNormalDelayedSho1 involved in germination signaling
Colony morphologyRegularIrregularSho1 regulates hyphal development
Stress sensitivityNormalHypersensitiveSho1 required for stress adaptation
Complemented strainNormalNormalPhenotype specific to sho1 deletion

When analyzing A. clavatus sho1 mutants, compare results with those from A. fumigatus, where sho1 deletion resulted in reduced growth rate, delayed germination, and irregular hyphal morphology .

What are the most informative experimental controls for studies of recombinant Sho1 protein?

When conducting studies with recombinant A. clavatus Sho1 protein, the following controls are critical:

Genetic Controls:

  • Wild-type strain: Baseline for all phenotypic comparisons

  • sho1 deletion mutant: Negative control lacking the protein of interest

  • Complemented strain: Restoration of wild-type sho1 gene to confirm specificity of observed phenotypes

  • Partial complementation: Expression of specific Sho1 domains to map functional regions

Protein Expression Controls:

  • Empty vector control: Cells containing expression vector without sho1 gene

  • Unrelated membrane protein control: To distinguish general membrane protein effects

  • Denatured protein control: To confirm structure-dependent functions

  • Tag-only control: If using tagged proteins, to identify tag-specific effects

Functional Assays Controls:

  • Positive control stressors known to activate HOG-MAPK pathway

  • Dose-response curves to determine appropriate stressor concentrations

  • Time-course experiments to capture dynamic responses

  • Inhibitor controls (e.g., kinase inhibitors) to confirm pathway specificity

How can researchers distinguish direct versus indirect effects of Sho1 on fungal phenotypes?

Distinguishing direct from indirect effects of Sho1 on fungal phenotypes requires multiple complementary approaches:

Temporal Analysis:

  • Use inducible promoter systems to control sho1 expression

  • Monitor rapid responses (within minutes) which are more likely direct effects

  • Track phenotypic changes over time to separate primary from secondary effects

Pathway Dissection:

  • Analyze phosphorylation state of known HOG pathway components (e.g., Pbs2, Hog1)

  • Create double mutants lacking sho1 and downstream components

  • Use specific inhibitors of pathway components to identify where Sho1 signals intersect

Protein Interaction Studies:

  • Co-immunoprecipitation to identify direct binding partners

  • Yeast two-hybrid screening to map protein-protein interactions

  • Bimolecular fluorescence complementation to visualize interactions in vivo

  • Domain deletion/mutation studies to identify critical interaction regions

Transcriptomic Analysis:

  • Compare gene expression profiles between wild-type and sho1 mutants

  • Identify genes with expression changes under normal and stress conditions

  • Use pathway enrichment analysis to determine affected biological processes

  • Validate key findings with RT-PCR and reporter gene assays

How does the function of Sho1 in A. clavatus compare to homologs in other pathogenic fungi?

The function of Sho1 varies somewhat across fungal species, despite sequence conservation:

Comparison Table of Sho1 Functions Across Fungal Species:

SpeciesSequence Identity to A. fumigatusRole in Osmotic StressRole in Oxidative StressMorphogenesis RegulationVirulence Impact
A. fumigatus100%MinorMajorSignificantMinimal
A. clavatus83%Predicted similar to A. fumigatusPredicted similar to A. fumigatusLikely significantUnknown
A. nidulans71%UnknownUnknownUnknownN/A
S. cerevisiae71%MajorModerateLimitedN/A
C. albicansNot specifiedMinorMajorMajorSignificant

In A. fumigatus, Sho1 primarily contributes to oxidative stress adaptation and morphogenesis but appears less critical for virulence . This differs from C. albicans, where Sho1 plays a more significant role in linking oxidative stress to morphogenesis and cell wall biosynthesis, with greater implications for virulence .

For A. clavatus, researchers should investigate whether its ecological niche and lifestyle correlate with functional specializations of its Sho1 protein.

What structural features distinguish A. clavatus Sho1 from other Aspergillus Sho1 proteins?

While specific structural details of A. clavatus Sho1 are not provided in the search results, we can make predictions based on the high sequence identity (83%) with A. fumigatus Sho1 :

  • The four transmembrane domains are likely highly conserved in position and amino acid composition

  • The SH3 domain at the C-terminus is probably highly conserved due to its critical protein-protein interaction function

  • Variations may occur primarily in the linker regions between functional domains

Researchers should conduct detailed structural analyses to identify:

  • Specific amino acid substitutions in functional domains

  • Potential differences in post-translational modification sites

  • Variations in protein folding that might affect ligand binding or protein-protein interactions

What emerging technologies will advance our understanding of Sho1 function in Aspergillus species?

Several cutting-edge technologies hold promise for deeper insights into Sho1 function:

CRISPR-Cas9 Genome Editing:

  • Creation of precise point mutations in Sho1 functional domains

  • Generation of conditional Sho1 expression systems

  • Introduction of fluorescent protein fusions at endogenous loci

Advanced Microscopy:

  • Super-resolution microscopy to visualize Sho1 localization during stress responses

  • Single-molecule tracking to monitor Sho1 dynamics in living cells

  • FRET-based biosensors to detect Sho1-mediated signaling events in real-time

Structural Biology Approaches:

  • Cryo-EM analysis of Sho1 in membrane environments

  • NMR studies of Sho1 domains and their interactions with binding partners

  • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during signaling

Systems Biology Integration:

  • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

  • Computational modeling of Sho1-regulated signaling networks

  • Comparative genomics across Aspergillus species to identify conserved regulatory elements

How might Sho1-targeted research contribute to broader understanding of fungal adaptation mechanisms?

Research on Sho1 in A. clavatus and other Aspergillus species has significant implications for understanding fundamental aspects of fungal biology:

  • Stress sensing mechanisms: Elucidating how membrane proteins like Sho1 detect environmental perturbations and transduce signals

  • Signal integration: Understanding how multiple stress response pathways interact and coordinate appropriate adaptive responses

  • Morphogenetic regulation: Clarifying links between stress signaling and developmental processes like germination, hyphal growth, and sporulation

  • Evolutionary adaptation: Comparing Sho1 function across species can reveal how signaling pathways evolve to suit specific ecological niches

  • Fungal pathogenesis: Although A. fumigatus Sho1 appears minimally involved in virulence , understanding species-specific variations in Sho1 function may provide insights into pathogenicity mechanisms in different fungi

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.