Recombinant Aspergillus clavatus Mitochondrial outer membrane protein iml2 (iml2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks if needed. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
iml2; ACLA_025180; Inclusion body clearance protein iml2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-721
Protein Length
full length protein
Species
Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
Target Names
iml2
Target Protein Sequence
MFRVGSWLYGKKPANASTQSLDSLVELRDPATLILNDDVDGAEDGLAEGTSSFHNLGRGV VAFIRATLGFEQDIMRQASERLNEAETTASVDQHRAQHNSQAPNTYHSAMYTPGTEFALC QAMAQLMGAVVGVLNESLTESIKGFYRLRKAYITLDAILKMEQKYLQESRMATPIESAAP GSIPLSMKRQGSSNLQSSSSSISSAKIKKAASSATTLAAPVENTDLSERLTGLNLSSETL APGDVKEASTLGPADMLNHDPDSDIFHNQIDIFVHSGSNFCFGILLLLISMVPPAFSKLL SIIGFHGDKERGLRMLWQASKFHNLIGAIAAFSVLGYYNGFVRYCDIMPDSIPGQDEDVQ GYPQERLELLLAKMRKQFPKSQLWVLEESRMCGANKNLDRALELLCGGESSPLKQVEALR LFERSLNAMYLHKYELCAASFLECFELNTWSRSLYYYITGSCHLSLYRNALDKDPAKAAE HAELAEKYFRLAPPLAGKKRFMARQLPFDVFVARKVAKWEARAKDWKVPLVDAVGVDPIE EMIFFWNGHSRMTDEHLLESLQKLAWCESSANKTWSREGPEEKAILKLLRAAVFRSLRKH SQAKDLLEDILSQDRNLFKGHLKDDWICPVAHFEMAANMWMERPTYIAIHGGSKEFTDPE ATEPADSSKSLEYEREKVHKCKEYLEKAAKWESYELDARIGLKVTAAMEAVQKWENTHPP A
Uniprot No.

Target Background

Function
Recombinant *Aspergillus clavatus* Mitochondrial outer membrane protein iml2 (Iml2) is an inclusion body (IB)-resident protein exhibiting strong interaction with lipid droplet (LD) proteins. It is involved in LD-mediated IB clearance following protein folding stress, likely by facilitating access to IBs of an LD-stored soluble sterol derivative acting as a chaperone in inclusion clearing.
Database Links
Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is the Iml2 protein in Aspergillus clavatus and what is its primary function?

Iml2 is a mitochondrial outer membrane protein found in Aspergillus clavatus, likely involved in mitochondrial import pathways similar to other fungal mitochondrial membrane proteins. Based on homology studies with related proteins, Iml2 is hypothesized to function in protein import and possibly in mitochondrial quality control mechanisms . Unlike some other mitochondrial proteins, Iml2 likely lacks a cleavable mitochondrial presequence, suggesting it may utilize Tom70-dependent import pathways similar to carrier proteins in other fungal species . Current research indicates its potential role in maintaining mitochondrial membrane integrity and function, though specific biochemical characterization in A. clavatus requires further investigation.

What are the predicted structural characteristics of Iml2?

As a mitochondrial outer membrane protein, Iml2 likely contains:

  • Hydrophobic transmembrane domains for membrane anchoring

  • Recognition sequences for mitochondrial import machinery

  • Potential interaction domains with other membrane proteins

  • Possible substrate binding regions if involved in transport

Based on structural studies of similar mitochondrial membrane proteins, Iml2 likely adopts an alpha-helical conformation within the membrane, with soluble domains extending into the cytosol and/or intermembrane space . The protein likely lacks a cleavable presequence, instead containing internal targeting signals that direct it to the mitochondrial outer membrane through the Tom70 receptor pathway .

What are the optimal conditions for recombinant expression of A. clavatus Iml2?

Successful recombinant expression of mitochondrial membrane proteins like Iml2 requires careful consideration of expression systems and conditions. Based on methodologies used for similar proteins, the following approach is recommended:

Table 1: Comparison of Expression Systems for Recombinant Iml2 Production

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliHigh yield, cost-effective, rapid growthPotential misfolding of eukaryotic proteins, lack of post-translational modificationsUse specialized strains (e.g., C41/C43), fusion tags (SUMO, MBP), lower induction temperature (16-20°C)
Yeast (P. pastoris, S. cerevisiae)Eukaryotic folding machinery, post-translational modificationsLower yield than E. coli, longer cultivation timeOptimize codon usage, use inducible promoters, glycerol-methanol feeding strategy
Baculovirus-insect cellSuperior folding of complex proteins, post-translational modificationsHigher cost, technical complexityOptimize MOI, harvest timing, supplement with lipids for membrane proteins
Cell-free systemsAvoids toxicity issues, rapid productionLower yield, higher costSupplement with detergents or lipids, optimize redox conditions

For membrane proteins like Iml2, yeast expression systems often provide a good balance between proper folding and reasonable yield, particularly when coupled with appropriate solubilization strategies during purification .

What purification strategy should be used to obtain pure, functional Iml2 protein?

Purification of mitochondrial membrane proteins requires specialized techniques to maintain protein stability and function:

  • Initial extraction: Solubilize membrane fractions using mild detergents (DDM, LMNG, or Fos-choline-12) at concentrations just above their critical micelle concentration.

  • Affinity chromatography: Utilize His-tag, FLAG-tag, or Strep-tag purification depending on the construct design. Include detergent at concentrations above CMC but below disruptive levels throughout all purification steps.

  • Size exclusion chromatography: Perform as a polishing step to remove aggregates and ensure homogeneity.

  • Alternative approaches: Consider amphipol exchange for improved stability or reconstitution into nanodiscs or liposomes for functional studies.

The purification protocol should include reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of cysteine residues and protease inhibitors to minimize degradation . Monitoring protein integrity throughout purification using SDS-PAGE is essential, with special attention to potential aggregation or degradation products.

How can researchers assess the quality and functionality of purified recombinant Iml2?

Multiple complementary approaches should be employed to verify protein quality:

Table 2: Characterization Techniques for Recombinant Iml2

TechniqueInformation ObtainedExperimental Considerations
Circular Dichroism (CD)Secondary structure composition, thermal stabilityRequires detergent-solubilized protein or reconstitution into lipid nanodiscs
Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS)Oligomeric state, homogeneity, molecular weightMust account for detergent/lipid contribution to measurements
Surface Plasmon Resonance (SPR)Binding kinetics with potential interaction partnersRequires immobilization strategies compatible with membrane proteins
Proteoliposome ReconstitutionFunctional analysis in near-native environmentCritical to achieve proper orientation in liposomes
Microscale Thermophoresis (MST)Binding affinities in solutionCompatible with detergent-solubilized proteins

Functional assessments should focus on mitochondrial import activity if Iml2 is involved in import pathways. This could involve reconstitution experiments with isolated mitochondria and radiolabeled substrate proteins to measure import efficiency in the presence or absence of recombinant Iml2 .

How can recombinant Iml2 be used to study mitochondrial quality control mechanisms?

Recombinant Iml2 provides a valuable tool for investigating mitochondrial quality control pathways similar to those identified in yeast models:

  • Protein-protein interaction studies: Utilize techniques such as pull-down assays, crosslinking mass spectrometry, or proximity labeling to identify Iml2 interaction partners, potentially revealing its role in protein complexes involved in mitochondrial quality control.

  • Reconstitution experiments: In vitro reconstitution of Iml2 with other components of mitochondrial membrane allows for mechanistic studies of protein import or degradation pathways.

  • Mitochondrial-derived compartment (MDC) analysis: Based on findings with Tom70/71 in yeast, investigate whether Iml2 participates in the formation of MDCs during stress responses . This could involve fluorescence microscopy of tagged proteins and mitochondrial membrane potential measurements using dyes like TMRM.

  • Comparative analysis: Compare the function of Iml2 from A. clavatus with homologs from other species to identify conserved and divergent aspects of mitochondrial quality control mechanisms.

Research suggests that some mitochondrial membrane proteins are selectively targeted for degradation through MDC formation under specific stress conditions, and proteins like Iml2 might play regulatory roles in this process .

What approaches can be used to develop antibodies against A. clavatus Iml2 for research applications?

Development of specific antibodies against Iml2 can be approached through multiple strategies:

  • Phage display technology: Similar to the approach used for A. fumigatus Crf2, phage display using naive or immune antibody gene libraries can generate single-chain variable fragments (scFvs) with high specificity . This requires:

    • Proper presentation of Iml2 during selection to maintain native conformation

    • Multiple selection rounds with increasing stringency

    • Thorough characterization of binding specificity across related Aspergillus species

  • Epitope mapping and synthetic peptide approach: Identify immunogenic regions unique to A. clavatus Iml2 through computational analysis and generate antibodies against synthetic peptides representing these regions.

  • Recombinant antibody engineering: Once lead antibody candidates are identified, affinity maturation and formatting (conversion to Fab, IgG, etc.) can optimize performance for specific applications.

Table 3: Antibody Format Comparison for Iml2 Detection

Antibody FormatAdvantagesLimitationsPreferred Applications
scFvSmall size, tissue penetration, economic productionMonovalent binding, shorter half-lifeImaging, intracellular expression
FabMedium size, stable, consistent productionMonovalent bindingCrystallography, SPR, ELISA
IgGBivalent, extended half-life, effector functionsLarger size, more expensive productionImmunoprecipitation, Western blotting
NanobodiesSmallest size, stability, reaches cryptic epitopesLimited commercial availabilitySuper-resolution microscopy, conformation-specific detection

Thorough validation of antibody specificity is essential, including testing against related Aspergillus species to ensure specific recognition of A. clavatus Iml2 .

How can genomic and transcriptomic approaches enhance our understanding of Iml2 regulation?

Advanced genomic and transcriptomic techniques provide powerful tools for investigating Iml2 regulation:

  • Promoter analysis: Identify regulatory elements in the promoter region of the iml2 gene using comparative genomics across Aspergillus species to predict transcription factor binding sites.

  • RNA-Seq under different conditions: Analyze transcriptional changes of iml2 under various stress conditions (oxidative stress, mitochondrial depolarization, nutrient limitation) to understand its regulation.

  • ChIP-Seq: Identify transcription factors that bind to the iml2 promoter under different conditions.

  • CRISPR-Cas9 genome editing: Generate precise mutations in regulatory regions to validate their importance in iml2 expression.

  • Single-cell RNA-Seq: Investigate cell-to-cell variation in iml2 expression, potentially revealing heterogeneity in mitochondrial stress responses.

For data analysis, consider employing:

  • Differential expression analysis with appropriate statistical correction for multiple testing

  • Pathway enrichment analysis to identify co-regulated genes

  • Network analysis to place Iml2 in the context of broader cellular responses

When handling missing data in large-scale studies, employ statistically valid approaches such as multiple imputation rather than simplistic methods like single imputation or LOCF, as these can introduce bias .

What microscopy techniques are most suitable for studying the localization and dynamics of Iml2?

Several advanced microscopy techniques can be applied to study Iml2 localization and dynamics:

  • Confocal microscopy with fluorescent protein fusions: Create C- or N-terminal fusions of Iml2 with fluorescent proteins (e.g., GFP, mCherry) for live-cell imaging of localization patterns. Super-resolution microscopy (STED, PALM, STORM) can provide more detailed localization data beyond the diffraction limit.

  • Immunofluorescence microscopy: Using validated anti-Iml2 antibodies for visualization in fixed samples, particularly useful when combined with co-staining for other mitochondrial markers. This approach has been successfully used to localize proteins like Crf2 in Aspergillus species .

  • FRAP (Fluorescence Recovery After Photobleaching): To study the mobility and turnover of Iml2 within the mitochondrial membrane.

  • Split-fluorescent protein complementation: To investigate protein-protein interactions involving Iml2 in live cells.

  • Time-lapse imaging: To monitor dynamic changes in Iml2 localization during cellular responses to stressors that affect mitochondrial function.

When analyzing microscopy data, consider employing machine learning-based segmentation approaches as they can provide more consistent and objective quantification compared to manual methods .

How can researchers effectively study the protein-protein interactions of Iml2?

Multiple complementary approaches should be used to comprehensively characterize Iml2 interactions:

  • Affinity purification coupled with mass spectrometry (AP-MS): Using tagged Iml2 to pull down interaction partners under different conditions, followed by identification via LC-MS/MS.

  • Proximity labeling approaches: BioID or APEX2 fused to Iml2 to biotinylate proximal proteins, capturing both stable and transient interactions in the native cellular environment.

  • Crosslinking mass spectrometry (XL-MS): Chemical crosslinking of protein complexes followed by MS analysis to identify not only interaction partners but also specific interaction interfaces.

  • Yeast two-hybrid screening: While challenging for membrane proteins, modified membrane yeast two-hybrid systems can be employed.

  • Co-immunoprecipitation: Using validated anti-Iml2 antibodies to pull down native protein complexes.

  • FRET/BRET assays: For investigating specific hypothesized interactions in live cells.

Data analysis should include proper controls to distinguish true interactions from background contaminants, and validation of key interactions through multiple orthogonal techniques. Statistical approaches for analyzing interaction proteomics data should account for missing values appropriately, potentially using multiple imputation techniques rather than simple exclusion of incomplete data .

What are the best approaches for studying the role of Iml2 in mitochondrial dysfunction and cellular stress responses?

To investigate Iml2's role in mitochondrial dysfunction and stress responses:

  • Gene knockout/knockdown studies: Generate iml2 deletion mutants or employ RNAi/CRISPR interference approaches to reduce Iml2 levels, then characterize phenotypes under various stress conditions:

    • Oxidative stress (hydrogen peroxide, paraquat)

    • Mitochondrial depolarizing agents (FCCP, antimycin A)

    • Nutrient limitation

    • Temperature stress

  • Site-directed mutagenesis: Create point mutations in functional domains to identify critical residues for Iml2 function.

  • Mitochondrial function assays: Measure parameters such as:

    • Membrane potential using fluorescent dyes (TMRM, JC-1)

    • Oxygen consumption rate

    • ATP production

    • ROS generation

    • Mitochondrial morphology

  • Proteolytic degradation analysis: Study the turnover of Iml2 under stress conditions using approaches such as the RITE tag system, which allows tracking of protein turnover through epitope switching .

  • Mitochondrial import assays: Assess whether Iml2 depletion affects the import efficiency of various mitochondrial proteins.

When analyzing complex datasets from these experiments, proper statistical approaches should be employed for handling missing data, such as multiple imputation methods rather than simpler approaches like listwise deletion, which can reduce statistical power .

How should researchers approach statistical analysis of experiments involving Iml2?

Statistical analysis for Iml2-related experiments should follow these methodological principles:

  • Experimental design considerations:

    • Ensure adequate sample size through power analysis

    • Include appropriate controls (positive, negative, and vehicle)

    • Use randomization and blinding where possible

    • Consider biological replicates (different cultures/animals) vs. technical replicates

  • Basic analytical approaches:

    • Test for normality before selecting parametric vs. non-parametric tests

    • Apply appropriate transformations if needed (log, square root) for non-normal data

    • Use paired tests for before-after comparisons within the same samples

    • Employ multivariate analyses for experiments with multiple dependent variables

  • Handling missing data:

    • Avoid simplistic approaches like single imputation or last observation carried forward

    • Instead, utilize multiple imputation techniques which preserve natural variability and incorporate uncertainty

    • Document all instances and patterns of missing data transparently

    • Consider whether data is missing completely at random (MCAR), missing at random (MAR), or missing not at random (MNAR)

  • Advanced considerations:

    • For high-dimensional data, employ appropriate correction for multiple testing

    • For longitudinal studies, consider mixed-effects models rather than repeated measures ANOVA

    • For imaging data, consider machine learning approaches for objective quantification

What are common pitfalls in interpreting functional studies of mitochondrial membrane proteins like Iml2?

Researchers should be aware of several common challenges when interpreting results:

  • Overexpression artifacts: Overexpression of membrane proteins can disrupt membrane integrity and cause non-physiological aggregation. Control experiments with different expression levels should be performed to ensure observed phenotypes are not artifacts.

  • Tag interference: Fusion tags (GFP, His, etc.) may affect protein folding, localization, or function. Validation with differently tagged constructs or complementary untagged approaches is recommended.

  • Context dependency: Protein function may differ significantly between in vitro and in vivo settings, or between heterologous expression systems and native contexts. Verify key findings in multiple systems.

  • Compensatory mechanisms: Knockout or knockdown studies may trigger compensatory expression of related proteins, masking phenotypes. Consider acute inactivation strategies or double/triple knockouts of related genes.

  • Pleiotropy: Changes in mitochondrial membrane proteins often have widespread effects due to the central role of mitochondria in metabolism. Distinguishing primary from secondary effects requires careful experimental design.

  • Strain and species differences: Function may vary across fungal strains or species. Comparative studies across multiple Aspergillus species can reveal conserved versus species-specific functions .

  • Missing data interpretation: When analyzing datasets with missing values, researchers should consider the mechanism of missingness and use appropriate statistical approaches rather than simplistic deletion methods .

How can researchers integrate multi-omics data to better understand Iml2 function in the context of mitochondrial biology?

Multi-omics integration provides a comprehensive view of Iml2 function:

  • Data collection strategies:

    • Perform parallel analyses (proteomics, transcriptomics, metabolomics) on the same samples

    • Include temporal dimensions to capture dynamic responses

    • Compare wildtype and iml2 mutant strains under both normal and stress conditions

  • Integration approaches:

    • Network-based integration: Construct protein-protein interaction networks centered on Iml2, integrating transcriptional co-expression data and metabolic connections

    • Pathway enrichment analyses across multiple omics layers

    • Machine learning approaches to identify patterns across datasets

    • Causal inference methods to predict regulatory relationships

  • Validation strategies:

    • Targeted experimental validation of key predictions

    • Cross-validation between independent datasets

    • Literature-based validation of predicted relationships

  • Visualization and interpretation:

    • Interactive visualization tools for multi-dimensional data

    • Hierarchical clustering to identify co-regulated processes

    • Principal component analysis to identify major sources of variation

  • Handling missing data:

    • Multi-omics datasets often contain missing values

    • Employ multiple imputation techniques rather than simple deletion or single-value imputation

    • Consider imputation methods specifically designed for each omics type

For machine learning approaches to data integration and pattern recognition, proper segmentation and feature selection are critical for obtaining reliable results . All analytical pipelines should be documented with sufficient detail to ensure reproducibility.

What is the potential relevance of Iml2 research to understanding fungal pathogenicity?

Research on mitochondrial membrane proteins like Iml2 has significant implications for understanding fungal pathogenicity:

  • Stress adaptation mechanisms: Mitochondrial quality control is crucial for adaptation to host environments. Iml2 may participate in stress response pathways similar to the MDC pathway identified in yeast , potentially contributing to A. clavatus survival under host immune attack.

  • Species-specific differences: Comparative studies between pathogenic and non-pathogenic Aspergillus species can reveal how mitochondrial membrane proteins contribute to virulence, similar to how antibodies against Crf proteins can differentiate between Aspergillus species .

  • Drug target potential: Proteins involved in essential mitochondrial processes represent potential antifungal targets. Understanding Iml2's structure and function could inform the development of specific inhibitors if it proves to be essential for fungal viability or virulence.

  • Biomarker applications: If Iml2 or its fragments are released during fungal growth, they might serve as biomarkers for invasive aspergillosis, similar to how Crf proteins have been explored for diagnostic purposes .

  • Host-pathogen interactions: Investigating how host cells recognize and respond to fungal mitochondrial proteins could reveal new aspects of innate immunity against fungal pathogens.

Future research should explore whether Iml2 contributes to known virulence mechanisms such as stress resistance, morphological transitions, or evasion of host immune responses.

How can structural studies of Iml2 contribute to understanding mitochondrial membrane protein organization?

Structural characterization of Iml2 would provide valuable insights into mitochondrial membrane protein organization:

  • Membrane topology determination: Combining computational prediction with experimental approaches such as:

    • Protease protection assays

    • Site-directed fluorescence labeling

    • Cysteine accessibility methods

    • Cryo-electron microscopy

  • Structural determination approaches:

    • X-ray crystallography of detergent-solubilized protein or protein fragments

    • Cryo-EM of reconstituted protein in nanodiscs or amphipols

    • NMR studies of specific domains

    • Integrative structural biology combining multiple data sources

  • Functional implications:

    • Identification of interaction interfaces

    • Substrate binding sites if Iml2 functions in transport

    • Conformational changes associated with function

    • Structure-guided mutagenesis to test hypotheses about mechanism

  • Comparative structural biology:

    • Alignment with structures of related proteins across species

    • Identification of conserved structural features versus species-specific adaptations

    • Evolutionary analysis of structure-function relationships

These studies would contribute to the broader understanding of how mitochondrial outer membrane proteins are organized and function, potentially revealing common principles and unique features that could be exploited for research or therapeutic purposes.

What computational approaches can enhance Iml2 research and data interpretation?

Advanced computational methods can significantly enhance Iml2 research:

  • Protein structure prediction:

    • AlphaFold2 and RoseTTAFold for generating detailed structural models

    • Molecular dynamics simulations to study membrane integration and conformational dynamics

    • Protein-protein docking to predict interaction interfaces

  • Genomic analysis:

    • Comparative genomics across Aspergillus species to identify conserved regulatory elements

    • Analysis of selection pressure on different protein domains

    • Prediction of post-translational modifications

  • Data integration and mining:

    • Network analysis to place Iml2 in the context of mitochondrial function

    • Text mining of literature to identify functional connections

    • Integration of proteomics, transcriptomics, and metabolomics data

  • Machine learning applications:

    • Prediction of functional partners based on co-expression patterns

    • Automated image analysis for localization studies

    • Pattern recognition in phenotypic data from mutant studies

  • Statistical approaches for experimental design and analysis:

    • Power analysis for optimal experimental design

    • Multiple imputation techniques for handling missing data in large datasets

    • Bayesian inference methods for integrating prior knowledge with new data

  • Interactive visualization tools:

    • For complex multi-dimensional datasets

    • Network visualization for protein-protein interactions

    • Structural visualization for analyzing protein features

These computational approaches should be employed with appropriate validation strategies, including experimental verification of key predictions and sensitivity analysis to assess the robustness of computational results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.