Recombinant Aspergillus clavatus NADH-cytochrome b5 reductase 1 (cbr1)

• How do amino acid sequence variations in cbr1 across different Aspergillus species affect enzyme kinetics and substrate specificity?

Comparative analysis of cbr1 sequences from various Aspergillus species reveals both conserved catalytic domains and species-specific variations:

Research methodologies to investigate these variations include:

• Site-directed mutagenesis: Systematically replace divergent residues to identify those critical for catalysis or substrate binding.

• Enzyme kinetics comparison: Determine Km and kcat values across species variants using standardized assay conditions.

• Molecular dynamics simulations: Model how sequence differences affect protein dynamics and substrate interactions.

• Inhibitor studies: Compare sensitivity profiles to identify species-specific binding pockets.

For example, the A. terreus cbr1 sequence (MSTFLQDNGDLSAVLVKFAPFAVAVIAILAAWKFTGSSKPRKVLNPSEFQNFVLKEKTDISHNVAIYRFALPRPTDILGLPIGQHISLAATIEGQPKEVVRSYTPISSDNEAGYFDLLVKAYPQGNISKYLTTLKIGDTLKVRGPKGAMVYTPNMCRHIGMIAGGTGITPMLQIIKAIIR...) exhibits differences in the membrane-binding domain compared to A. clavatus, potentially affecting its subcellular localization and access to lipophilic substrates.

• What role might cbr1 play in Aspergillus pathogenicity and how can recombinant protein be used to investigate this?

Though not directly characterized in pathogenicity, cbr1 may contribute to Aspergillus virulence through several mechanisms:

• Redox homeostasis: By maintaining cellular redox balance during host-pathogen interactions

• Detoxification pathways: Potentially metabolizing host-produced antimicrobial compounds

• Stress response: Contributing to adaptation during oxidative stress from host immune cells

Research approaches using recombinant cbr1 to investigate pathogenicity include:

Aspergillus infections represent significant clinical challenges, particularly invasive pulmonary aspergillosis in immunocompromised patients . Understanding the role of cbr1 in pathogenicity could reveal novel therapeutic targets, especially given that A. fumigatus is the predominant pathogenic species, followed by A. niger and other aspergilli .

• How do post-translational modifications affect cbr1 function, and what methods are available to characterize these modifications?

While specific post-translational modifications (PTMs) of Aspergillus cbr1 are not fully characterized in the provided references, potential modifications can be inferred from related proteins and investigated using several techniques:

A comprehensive investigation would include:

• Comparative expression: Produce cbr1 in both E. coli (lacks most PTMs) and eukaryotic systems, then compare activity profiles.

• Mass spectrometry analysis: Use high-resolution MS to map modification sites:

  • Bottom-up proteomics with enrichment for specific PTMs

  • Intact protein MS to determine heterogeneity

  • MS/MS fragmentation for site-specific analysis

• Functional impact studies: Create recombinant variants with modified PTM sites through site-directed mutagenesis to assess their contribution to:

  • Enzyme kinetics

  • Thermal stability

  • Subcellular localization

  • Protein-protein interactions

The selection of expression system significantly impacts PTM patterns—prokaryotic systems like E. coli typically lack eukaryotic PTM machinery, while mammalian cell expression may better recapitulate native modifications but with lower yields .

• What are the most effective experimental designs for studying cbr1 interactions with potential drug substrates?

Investigating cbr1's role in drug metabolism requires systematic approaches:

• Substrate screening methodology:

  • Incubate recombinant cbr1 with candidate drugs in the presence of NADH

  • Monitor NADH consumption spectrophotometrically (340 nm)

  • Analyze reaction products by LC-MS/MS

  • Compare with human CBR1 to identify species-specific metabolism

• Enzyme kinetics characterization:

• Structure-activity relationship studies:

  • Compare metabolism of structurally related compounds

  • Identify molecular features that determine substrate recognition

  • Develop predictive models for metabolism

The broad substrate specificity of CBR1 enzymes makes them significant in drug metabolism, particularly for carbonyl-containing compounds . Aspergillus cbr1 may serve as a model for understanding human CBR1 function or as a biocatalyst for drug development.

For example, carbonyl reductase 1 plays a critical role in the metabolism of ketones and aldehydes with broad substrate specificity, impacting the pharmacokinetics of numerous clinical drugs . Comparative studies between fungal and human enzymes could reveal evolutionary conservation of catalytic mechanisms.

• What strategies can overcome stability and solubility challenges when working with recombinant cbr1?

Maintaining stability and functionality of recombinant cbr1 requires careful consideration of several factors:

• Optimized buffer compositions:

• Storage and handling protocols:

  • Store at -20°C/-80°C in single-use aliquots

  • Avoid repeated freeze-thaw cycles (maximum storage at 4°C: one week)

  • Reconstitute lyophilized protein to 0.1-1.0 mg/mL in deionized water

  • Centrifuge vials briefly before opening to bring contents to the bottom

• Solubility enhancement strategies:

  • Co-expression with molecular chaperones

  • Fusion with solubility-enhancing tags (MBP, SUMO)

  • Refolding protocols if inclusion bodies form

  • Detergent screening for membrane-associated forms

• Activity preservation techniques:

  • Addition of FAD during purification (cofactor retention)

  • Reduced light exposure (photosensitive cofactors)

  • Inclusion of stabilizing ligands

  • Enzyme immobilization on solid supports for repeated use

These approaches can be systematically evaluated using thermal shift assays, activity retention studies, and long-term stability monitoring to establish optimal conditions for specific experimental applications.

• How can researchers develop selective inhibitors of Aspergillus cbr1, and what applications might these inhibitors have?

Developing selective inhibitors requires a systematic approach combining structural knowledge with screening strategies:

• Initial screening approaches:

  • High-throughput enzymatic assays with chemical libraries

  • In silico docking studies targeting the active site

  • Fragment-based screening to identify binding motifs

  • Repurposing known inhibitors of related reductases

• Selectivity profiling methodology:

  • Compare inhibition against human CBR1

  • Test against other Aspergillus oxidoreductases

  • Evaluate activity across cbr1 from different Aspergillus species

  • Determine selectivity indices (IC50 ratios)

• Structure-activity relationship development:

  • Synthesize analogs of hit compounds

  • Perform molecular dynamics simulations of binding

  • Map the binding site through mutagenesis studies

  • Optimize potency and physicochemical properties

• Potential applications of selective inhibitors:

Research indicates that selective inhibition of related enzymes can be achieved despite high structural conservation. For example, hydroxy-PP-Me has been used as a CBR1 inhibitor in experimental contexts to evaluate enzyme function , suggesting similar approaches could be developed for Aspergillus cbr1.