Recombinant Aspergillus clavatus Plasma membrane fusion protein prm1 (prm1)

Shipped with Ice Packs
In Stock

Description

Functional Role of Prm1 in Fungi

Prm1 is a conserved fungal plasma membrane protein critical for cell-cell fusion during mating and hyphal fusion. Key findings from other species include:

  • Membrane Fusion Efficiency:

    • In Saccharomyces cerevisiae, Neurospora crassa, and Cryptococcus neoformans, Prm1 deficiency reduces cell fusion efficiency by 40–95% and increases cell lysis rates under low calcium conditions .

    • Prm1 interacts with calcium signaling pathways, particularly through Fig1, to stabilize fusion pores and prevent membrane damage .

  • Structural Features:

    • Prm1 is a multi-pass transmembrane protein localized to mating/fusion zones .

    • Phylogenetic analyses show Prm1 orthologs share sequence homology (e.g., 91% identity between C. neoformans and C. deneoformans) but exhibit species-specific functional adaptations .

Hypothetical Properties of Recombinant Aspergillus clavatus Prm1

While direct studies on A. clavatus Prm1 are absent, comparative insights suggest:

PropertyExpected CharacteristicsBasis in Literature
Molecular Weight~30–40 kDa (predicted from homologs)C. neoformans Prm1: 38 kDa
LocalizationPlasma membrane, enriched at fusion zonesConservation in S. cerevisiae and C. neoformans
Calcium DependenceLikely enhances fusion fidelity under low Ca²⁺ conditionsFig1-Prm1 interaction in yeast
Role in PathogenicityPotential regulation of cell wall integrity/stress responsesC. neoformans Prm1 modulates chitosan synthesis and virulence

Research Gaps and Future Directions

  1. Sequence Conservation:

    • No A. clavatus Prm1 sequence is reported in UniProt or NCBI databases. A BLASTP analysis using known Prm1 sequences (e.g., C. neoformans CNAG_05866) is needed to confirm homology.

  2. Functional Validation:

    • Heterologous expression in model fungi (e.g., S. cerevisiae prm1Δ) could test fusion rescue capabilities.

    • Structural studies (cryo-EM) would clarify mechanistic differences from other fungal Prm1 orthologs.

  3. Biotechnological Applications:

    • If A. clavatus Prm1 regulates hyphal fusion, it could be engineered to enhance industrial fungal fermentation efficiency.

Key Challenges in Studying Recombinant Prm1

  • Membrane Protein Solubility: Prm1’s multi-pass transmembrane domains complicate purification.

  • Post-Translational Modifications: Fungal-specific glycosylation may affect antigenicity in vaccine development .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement when placing the order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage state, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
prm1; ACLA_050300; Plasma membrane fusion protein prm1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-736
Protein Length
full length protein
Species
Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
Target Names
prm1
Target Protein Sequence
MLFSRSGHSIFPLLPPYAAHAPTTNQGHIITMPPDGLTPYLGLRARLSQVWINRWTILLL LVLVRVLMAASGLQADMGTAKREALSACSSVESMGSSMASMPHYLSQGVNELTASGVETA VSGLKSMLMLTVTGVEELVLFIIKVLYQTYLCLFTLAVRGSVHVAVGVIKDAADFLNSTV KEVGDDIGKVVSTFEDGFNKFLDSVNSVASVFGGSVPTLDLNSSISTLENLQLPSSIDKG LDKLNNSLPTFDEVNNFTQTVLRTPFEEVKKLVNQSLGTYTFDRSLLPIPAKEQLKFCEG NDGIDSFFDNVGDLVMTARKIFIAVLILAAVLACIPMAWQEIRRWRSMKERSQLVRKEAH DPMDIVYIVSRPYTAAAGIKAASRFSNSRRQILVRWAIAYATTPAALFVLCLGIAGLFSC LCQYLLLHAVEKTVPELSTQVGAFADKVVDKLENASAAWANDANGVIGHMNQDLNQNVFG WVNTSTTALNDTLNTFVDKTTGVLNETFGGTILYEPLMDVFGCLIGLKVAGIQKGLTWVH DHAHIDFPLLPNDTFSRGAAASIASNNSDASDSFLADAGDQTSNKITEVVIRVVDKVEEG IRMETIISTAILLLWVFIALVGIVRALTLFWMRDRSRGEGGGAPSTSHHTSDAGGFDDVP LTAIPNPSAHSAPAPRYEATISTVVASRAIPTSNSFQHQDEKMGFAGERQYGSALKVDGA PDLRGSAYVEYGVEKH
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell fusion during mating by stabilizing the plasma membrane fusion event.
Database Links
Protein Families
PRM1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of Prm1 in fungal species?

Prm1 is a conserved plasma membrane protein required for plasma membrane fusion during cell-cell fusion in fungi. Studies in Saccharomyces cerevisiae and Neurospora crassa have shown that deletion of PRM1 reduces fusion frequency by approximately half and can lead to cell lysis. The phenotype varies depending on calcium availability, with high calcium alleviating the mutant phenotype and calcium depletion exacerbating it . In Schizosaccharomyces pombe, Prm1 deletion causes a 95% reduction in cell fusion frequency independent of extracellular calcium concentration, without the cell lysis phenotype seen in other species . Prm1 functions extend beyond sexual reproduction in some fungi, as it's also required for asexual hyphal fusion in N. crassa .

How is Prm1 conserved across different fungal species?

Prm1 is highly conserved throughout the fungal kingdom. BLASTP searches using Prm1 sequences from species including S. cerevisiae, Candida albicans, Aspergillus fumigatus, S. pombe, and N. crassa have identified homologs in Cryptococcus neoformans and C. deneoformans . This conservation underscores Prm1's fundamental importance in fungal biology, particularly in processes related to membrane fusion. Reciprocal BLASTP searches confirm the orthologous nature of these fungal Prm1 proteins across diverse species .

What experimental evidence demonstrates Prm1's role in membrane fusion?

In Cryptococcus neoformans, bilateral deletion of Prm1 (prm1Δ X prm1Δ) reduces cell fusion frequency to only 12% ± 4% of wild-type levels . Scanning electron microscopy (SEM) reveals that clamp cells and peg protrusions from adjacent hyphal compartments exhibit elongated tubular morphology in prm1 mutants compared to wild-type cells, suggesting a failure to undergo cell fusion . Transmission electron microscopy (TEM) directly demonstrates that plasma membranes fail to undergo fusion in these clamp cells . Additionally, DAPI staining shows single nuclei trapped in the clamp cells of prm1 mutants, confirming the fusion defect . These multiple lines of evidence firmly establish Prm1's essential role in the membrane fusion process.

How do calcium levels influence Prm1 function in membrane fusion?

The relationship between Prm1 function and calcium concentration varies among fungal species. In S. cerevisiae and N. crassa, the phenotype of prm1 deletion mutants is alleviated in the presence of high calcium and exacerbated upon calcium depletion . This suggests that calcium may provide an alternative or compensatory pathway for membrane fusion when Prm1 is absent. Interestingly, in S. pombe, Prm1 deletion causes a 95% reduction in cell fusion frequency regardless of extracellular calcium concentration . These species-specific differences highlight the complex relationship between Prm1 and calcium-dependent fusion mechanisms, which may also vary among Aspergillus species.

What cellular processes beyond mating involve Prm1 in fungi?

Beyond sexual reproduction, Prm1 participates in several cellular processes involving membrane fusion:

  • Asexual hyphal fusion: In N. crassa, Prm1 is required for asexual hyphal fusion, suggesting a broader role in fungal colony development .

  • Clamp cell-hyphal fusion: In C. neoformans, Prm1 mediates the fusion of clamp cells with adjacent hyphal compartments, which is crucial for maintaining dikaryotic status during fungal development .

  • Maintenance of membrane integrity: The cell lysis phenotype observed in some prm1 mutants suggests a role in maintaining membrane stability during fusion attempts .

These functions demonstrate Prm1's importance beyond sexual reproduction, potentially extending to various developmental and morphogenetic processes in fungi including Aspergillus species.

What are optimal methods for expressing and purifying recombinant A. clavatus Prm1?

Based on established protocols, recombinant A. clavatus Prm1 can be successfully expressed and purified using the following approach:

ParameterRecommended Condition
Expression systemE. coli
Construct designFull-length protein (1-736 aa) with N-terminal His-tag
Purification methodAffinity chromatography using His-tag
Final formLyophilized powder
Purity levelGreater than 90% as determined by SDS-PAGE
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0

For reconstitution, it's recommended to briefly centrifuge the vial before opening, then reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Adding glycerol to a final concentration of 5-50% is advised for long-term storage, with 50% being the standard recommendation .

How should researchers design experiments to investigate Prm1's role in Aspergillus membrane fusion?

A comprehensive experimental approach should include:

  • Gene deletion and complementation:

    • Generate Δprm1 deletion mutants using homologous recombination with an appropriate selectable marker

    • Create complementation strains by reintroducing the wild-type PRM1 gene

    • Verify constructs using PCR, real-time PCR, and Southern blot

  • Phenotypic characterization:

    • Assess colony morphology, growth rate, and microscopic features

    • Compare the colony diameter of deletion strains to wild-type and complementation strains

    • Examine hyphal branching, density, and other morphological characteristics

  • Fusion assays:

    • Develop cell fusion assays using genetically marked Aspergillus strains

    • Compare fusion frequencies between wild-type, Δprm1, and complemented strains

    • Examine the effect of calcium concentration on fusion rates

  • Microscopic analyses:

    • Use SEM to examine morphological features of fusion structures

    • Employ TEM to directly visualize membrane interfaces during fusion attempts

    • Apply fluorescence microscopy with nuclear stains to track nuclear behavior during fusion

  • Expression analysis:

    • Monitor PRM1 expression under different conditions using quantitative PCR

    • Compare expression profiles between wild-type and mutant strains

    • Identify potential regulatory pathways controlling PRM1 expression

What approaches can be used to visualize Prm1 localization in Aspergillus cells?

Several complementary approaches can be employed:

  • Immunofluorescence microscopy:

    • Develop specific antibodies against A. clavatus Prm1

    • Fix and permeabilize Aspergillus cells

    • Detect Prm1 using primary antibodies followed by fluorophore-conjugated secondary antibodies

    • Counterstain nuclei with DAPI as reference points

  • Fluorescent protein tagging:

    • Generate constructs expressing Prm1 fused to fluorescent proteins (GFP, mCherry)

    • Introduce constructs into Aspergillus through transformation

    • Verify functionality of tagged proteins through complementation assays

    • Perform time-lapse imaging to track dynamics during fusion events

  • Immunoelectron microscopy:

    • Use gold-conjugated antibodies to localize Prm1 at the ultrastructural level

    • This approach is particularly valuable for determining Prm1's exact position during membrane fusion events

  • Advanced microscopy applications:

    • Bioluminescence imaging (BLI) using gene-modified Aspergillus strains has been successfully applied for monitoring fungal infection progress

    • Similar approaches could be adapted for tracking Prm1 dynamics in living cells

What methods can be used to generate specific antibodies against A. clavatus Prm1?

Based on successful approaches with other Aspergillus antigens, researchers can:

  • Prepare suitable antigens:

    • Use purified recombinant full-length A. clavatus Prm1

    • Design synthetic peptides corresponding to predicted immunogenic regions

    • Express and purify specific domains of Prm1

  • Generate monoclonal antibodies:

    • Immunize mice with the chosen antigen

    • Perform hybridoma fusion and screening

    • Select clones producing specific, high-affinity antibodies

  • Validation strategies:

    • Verify specificity using ELISA, Western blotting, and immunoprecipitation

    • Test for cross-reactivity with Prm1 from other Aspergillus species

    • Evaluate detection of native Prm1 in cellular contexts

Several successful monoclonal antibody development approaches against Aspergillus antigens have been reported. For example, researchers have developed mAbs against recombinant Aspergillus mannoprotein 1 that were highly specific to certain Aspergillus species, and similar approaches could be applied to Prm1 . Other researchers have developed mAbs against Aspergillus cell wall glycoproteins capable of detecting secreted antigens, providing models for Prm1-targeted antibodies .

How should researchers interpret functional studies of Prm1 across different Aspergillus species?

When analyzing Prm1 function across different Aspergillus species, researchers should:

  • Consider evolutionary context:

    • Perform phylogenetic analysis of Prm1 sequences

    • Examine conservation of key domains that might explain functional differences

    • Consider the evolutionary relationships between species showing different phenotypes

  • Evaluate experimental variables systematically:

    • Standardize key parameters (calcium concentration, pH, temperature) across experiments

    • Control for strain background effects that might influence results

    • Consider the developmental stage and physiological state of the fungi

  • Apply multiple experimental approaches:

    • Combine genetic, biochemical, and cell biological methods

    • Use quantitative measurements where possible

    • Verify key findings using independent experimental strategies

Specific caution is warranted regarding calcium-dependent effects, as Prm1 function shows dramatically different calcium dependence between fungal species . Similar variations might exist among different Aspergillus species and should be systematically evaluated.

What bioinformatic approaches are most useful for analyzing Prm1 sequences from Aspergillus species?

A comprehensive bioinformatic analysis of Prm1 should include:

  • Sequence comparison tools:

    • Multiple Sequence Alignment to compare Prm1 across Aspergillus species

    • Conservation analysis to identify critical functional residues

    • Phylogenetic analysis to understand evolutionary relationships

  • Structural prediction:

    • Transmembrane domain prediction (critical for membrane proteins like Prm1)

    • Secondary structure analysis

    • Three-dimensional structure prediction using modern AI-based tools

  • Functional element identification:

    • Motif prediction to identify functional domains

    • Post-translational modification site prediction

    • Protein-protein interaction site prediction

For genomic analysis of Aspergillus species, next-generation sequencing approaches have been successfully employed. For example, the Illumina Miseq 2000 system using paired-end libraries has been used for Aspergillus genome sequencing . For more complete assemblies, PacBio RS II systems with longer reads can be utilized, as demonstrated in Aspergillus genomic studies .

How can researchers create and verify Prm1 deletion mutants in Aspergillus?

The following methodological approach is recommended:

  • Construct design:

    • Design primers to amplify flanking regions of the PRM1 gene

    • Clone these regions into a vector containing a selectable marker (e.g., pyrG)

    • The construct will replace PRM1 with the marker through homologous recombination

  • Transformation protocol:

    • Prepare Aspergillus protoplasts through enzymatic digestion of cell walls

    • Transform with the deletion construct

    • Select transformants on appropriate media

    • Isolate candidate deletion mutants

  • Comprehensive verification:

    • PCR verification using primers spanning junction regions

    • Real-time PCR to confirm absence of PRM1 expression

    • Southern blot analysis to confirm the deletion and rule out ectopic integrations

  • Complementation controls:

    • Generate complementation strains by reintroducing wild-type PRM1

    • Verify restoration of phenotypes in complemented strains

    • This crucial control confirms phenotypes are specifically due to PRM1 deletion

Successful approaches for Aspergillus gene deletion have been reported using homologous recombination with Aspergillus fumigatus pyrG as a selection marker in Aspergillus flavus strains . The ΔAflvps35 mutant was constructed and verified by PCR, real-time PCR, and southern blot procedures, providing a model for similar approaches with PRM1 .

What analytical techniques can evaluate calcium dependency of Prm1 function in Aspergillus?

To investigate calcium's role in Prm1-mediated fusion:

  • Comparative fusion assays:

    • Perform fusion assays under varying calcium concentrations

    • Compare wild-type and Δprm1 strains at each calcium level

    • Include calcium chelators (EGTA, BAPTA) to create low-calcium conditions

  • Calcium imaging:

    • Use calcium-sensitive fluorescent dyes to monitor calcium dynamics during fusion

    • Compare calcium flux patterns between wild-type and Δprm1 strains

    • Correlate calcium signals with fusion success or failure

  • Protein-level analyses:

    • Assess Prm1 conformation changes under different calcium conditions

    • Investigate calcium-dependent protein-protein interactions

    • Identify potential calcium-binding domains within Prm1

  • Genetic interaction studies:

    • Create double mutants of prm1 and calcium channel/transporter genes

    • Analyze synthetic phenotypes that might reveal functional relationships

    • Test the effect of calcium channel blockers on fusion in wild-type and mutant strains

These approaches would help elucidate whether Aspergillus Prm1 functions in a calcium-dependent manner similar to S. cerevisiae and N. crassa Prm1, or whether it shows calcium independence as observed in S. pombe .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.