Recombinant Aspergillus clavatus Protein get1 (get1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
get1; ACLA_045650; Protein get1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
Target Names
get1
Target Protein Sequence
MLSLILTIFFVHVAIYLVNTAGASTIDTALWALYLKLPTSTAKNAREQSRLKREVVQLNR EMNNTSSQDEFAKWAKLRRRHDKAKDEYETINQALTSQKTSFDWAVKIARWLSTSGLKIF LQFYYSKTPVFALPAGWFPSIVEWMLSFPRAPRGSVSVQVWNSVCATAIAVMAEIFAAML VRMRGQAAARTPAAKAQKTQ
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Functions as a membrane receptor for soluble Get3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Aspergillus clavatus Protein get1 and what is its function?

The Aspergillus clavatus get1 protein (UniProt ID: A1CGU5) is a 200-amino acid protein that functions as a Guided entry of tail-anchored proteins 1 component . The protein is part of the GET complex (Guided Entry of Tail-anchored proteins) which plays a crucial role in the post-translational insertion of tail-anchored proteins into the endoplasmic reticulum membrane. Get1 typically forms a transmembrane complex that serves as a receptor for the targeting complex, facilitating the release and membrane insertion of tail-anchored proteins. In Aspergillus species, this protein contributes to proper membrane protein localization, which is essential for various cellular processes including protein secretion, stress response, and cell wall integrity. Understanding get1's function provides insights into fundamental aspects of protein trafficking in filamentous fungi.

What expression systems are most effective for recombinant get1 production?

  • Using specialized E. coli strains designed for membrane protein expression (C41, C43)

  • Testing different fusion partners (MBP, SUMO) to increase solubility

  • Exploring eukaryotic expression systems such as Pichia pastoris, particularly when studying protein-protein interactions

  • Implementing codon optimization for the target expression system

While E. coli remains the most commonly used system due to its simplicity and high yield, researchers studying functional aspects should consider fungal expression systems like Aspergillus nidulans or Pichia pastoris, which provide more native-like post-translational modifications and membrane environments .

What is the amino acid sequence and predicted structure of get1?

The full amino acid sequence of Aspergillus clavatus get1 protein (A1CGU5) is: "MLSLILTIFFVHVAIYLVNTAGASTIDTALWALYLKLPTSTAKNAREQSRLKREVVQLNR EMNNTSSQDEFAKWAKLRRRHDKAKDEYETINQALTSQKTSFDWAVKIARWLSTSGLKIF LQFYYSKTPVFALPAGWFPSIVEWMLSFPRAPRGSVSVQVWNSVCATAIAVMAEIFAAML VRMRGQAAARTPAAKAQKTQ" . Structural prediction analysis suggests get1 contains multiple transmembrane domains with both cytosolic and luminal regions. The protein likely adopts an alpha-helical conformation at the membrane-spanning regions, with the N-terminal region (approximately residues 1-20) forming the first transmembrane helix. Hydrophobicity analysis indicates the presence of three potential transmembrane domains, with the C-terminal portion (residues 170-200) likely residing in the cytosol and potentially involved in interactions with other GET complex components. Secondary structure predictions suggest a mix of alpha-helical regions in the transmembrane domains and more disordered regions in the soluble portions of the protein.

What purification strategies work best for His-tagged get1 protein?

Purification of His-tagged get1 protein requires specialized approaches due to its membrane-associated nature. The optimal purification protocol combines gentle solubilization with appropriate chromatography steps:

  • Initial solubilization of bacterial pellets should utilize mild detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin at concentrations just above their critical micelle concentration (CMC).

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin should be performed in the presence of detergent (typically 0.03-0.05% DDM) to maintain protein solubility.

  • A stepwise imidazole gradient (10 mM, 20 mM, 50 mM, 250 mM) is recommended for washing and elution to minimize co-purification of contaminating proteins.

  • Size exclusion chromatography as a final polishing step significantly improves purity and removes protein aggregates.

Buffer composition is critical, with typical buffers containing 20 mM Tris-HCl (pH 8.0), 150-300 mM NaCl, and appropriate detergent concentrations . For structural studies, detergent exchange to more suitable amphiphiles like LMNG or GDN may be required during the purification process. Protein purity should be assessed by SDS-PAGE, with expected purity levels exceeding 90% for most research applications .

How can researchers confirm the proper folding and functionality of recombinant get1?

Confirming proper folding and functionality of recombinant get1 requires multiple complementary approaches. Circular dichroism (CD) spectroscopy can provide information about secondary structure content, with properly folded get1 expected to show characteristic alpha-helical signatures (negative peaks at 208 nm and 222 nm). Thermal shift assays using differential scanning fluorimetry can assess protein stability, with properly folded protein showing cooperative unfolding transitions. For functional assessment, researchers should consider:

  • Reconstitution into liposomes followed by membrane insertion assays using fluorescently labeled tail-anchored substrates

  • Pull-down experiments to verify interactions with other GET pathway components

  • Protease protection assays to confirm proper membrane topology

  • Complementation studies in get1-deficient yeast strains to test for functional conservation

The combination of biophysical characterization and functional assays provides comprehensive validation of properly folded recombinant get1 protein. Researchers should establish negative controls using denatured protein and positive controls using well-characterized GET pathway components from model organisms .

What are the optimal storage conditions for maintaining get1 protein stability?

Maintaining the stability of recombinant get1 protein requires careful attention to storage conditions. The lyophilized form of the protein demonstrates the greatest long-term stability and can be stored at -20°C or -80°C for extended periods . For working solutions, the following recommendations apply:

  • Short-term storage (1-2 weeks): 4°C in Tris/PBS-based buffer containing detergent above its CMC

  • Medium-term storage (1-3 months): -20°C with 25% glycerol as cryoprotectant

  • Long-term storage (>3 months): -80°C with 50% glycerol in small aliquots to avoid freeze-thaw cycles

After reconstitution, the protein should be maintained at a concentration of 0.1-1.0 mg/mL in appropriate buffer . Repeated freeze-thaw cycles significantly reduce protein activity and should be avoided; working aliquots should be prepared upon initial thawing. The addition of 6% trehalose has been demonstrated to enhance stability during lyophilization and subsequent storage . Stability can be monitored periodically through activity assays or by analytical size exclusion chromatography to detect aggregation.

How does A. clavatus get1 compare to GET pathway proteins in other organisms?

The GET pathway is evolutionarily conserved across eukaryotes, though with notable structural and functional variations. Aspergillus clavatus get1 shares fundamental mechanistic features with homologs in other organisms while exhibiting fungal-specific adaptations. Sequence alignment analysis reveals moderate conservation (approximately 30-40% sequence identity) with Saccharomyces cerevisiae Get1p, particularly in the transmembrane domains. The cytosolic coiled-coil region, which in yeast interacts with the Get3 ATPase to facilitate tail-anchored protein release, shows several conserved charged residues. Compared to mammalian WRB (tryptophan-rich basic protein), A. clavatus get1 displays lower sequence conservation (approximately 20-25% identity) but predicted structural analysis suggests similar membrane topology.

Functional divergence analysis indicates that fungal get1 proteins, including the A. clavatus variant, may have specialized for efficient secretion of hydrolytic enzymes—a hallmark of filamentous fungi metabolism. Unlike the yeast system, where GET pathway disruption produces mild growth phenotypes, preliminary studies in filamentous fungi suggest more severe consequences, potentially reflecting expanded roles in hyphal growth and development. This comparative analysis provides valuable insights for researchers using A. clavatus get1 as a model for studying membrane protein insertion mechanisms across the fungal kingdom .

What experimental approaches can identify get1 interaction partners?

Identifying interaction partners of get1 requires multi-faceted approaches that account for its membrane-embedded nature. Researchers should employ complementary techniques including:

  • Affinity purification coupled with mass spectrometry (AP-MS): Using epitope-tagged get1 as bait, with careful optimization of detergent conditions to maintain native interactions. Crosslinking prior to cell lysis can capture transient interactions.

  • Yeast two-hybrid membrane system (split-ubiquitin assay): Modified to accommodate membrane proteins by fusing get1 to half of the ubiquitin molecule, with potential interactors fused to the complementary half.

  • Bimolecular fluorescence complementation (BiFC): Especially useful for validating interactions identified through screening approaches, by fusing get1 and candidate partners to complementary fragments of fluorescent proteins.

  • Proximity-dependent biotin identification (BioID): Fusing get1 to a promiscuous biotin ligase to biotinylate proximal proteins, followed by streptavidin pull-down and mass spectrometry.

Control experiments should include testing interactions with known GET pathway components (Get2/CAML homologs) as positive controls, and unrelated membrane proteins as negative controls. Researchers should be particularly attentive to detergent selection, as overly harsh detergents may disrupt authentic but weak interactions .

How can CRISPR/Cas9 technology be utilized to study get1 function in Aspergillus?

CRISPR/Cas9 technology offers powerful approaches for investigating get1 function in Aspergillus clavatus. Researchers can implement several strategies:

  • Gene disruption: Creating complete knockouts to assess essentiality and associated phenotypes. This approach requires efficient protoplast transformation protocols and appropriate selectable markers for Aspergillus clavatus, similar to those described for A. fumigatus .

  • Domain-specific modifications: Introducing precise mutations in transmembrane domains or interaction surfaces to dissect structure-function relationships without eliminating the entire protein.

  • Endogenous tagging: Adding fluorescent or epitope tags to the genomic locus to study native expression levels, localization patterns, and dynamic interactions without overexpression artifacts.

  • Promoter replacement: Substituting the native promoter with regulatable promoters (such as alcA) to create conditional expression strains, particularly valuable if get1 proves essential.

For efficient implementation, gRNA design should target unique sequences with minimal off-target potential. Transformation protocols must be optimized specifically for A. clavatus, adapting methods demonstrated for related species. The transformation efficiency can be significantly improved by using purified Cas9 protein complexed with in vitro transcribed gRNA rather than plasmid-based expression . Phenotypic analysis should examine not only growth rates but also hyphal morphology, protein secretion efficiency, and stress responses, as these may reveal condition-specific functions of get1.

How can researchers overcome inclusion body formation during get1 expression?

Inclusion body formation represents a significant challenge when expressing membrane proteins like get1. Researchers can implement several strategies to enhance soluble expression:

  • Temperature modulation: Lowering the expression temperature to 16-18°C significantly reduces inclusion body formation by slowing protein synthesis and allowing more time for proper folding and membrane insertion.

  • Induction optimization: Using lower concentrations of inducer (0.1-0.2 mM IPTG instead of 1 mM) and extending expression time (16-24 hours) often improves the soluble-to-insoluble protein ratio.

  • Fusion partner selection: Integrating solubility-enhancing tags such as MBP (maltose-binding protein), SUMO, or Fh8 at the N-terminus of get1 can dramatically improve solubility without interfering with the C-terminal membrane insertion.

  • Culture medium enrichment: Supplementing media with specific additives like 0.5-1% glucose, 1 mM proline, or 10 mM betaine can alleviate metabolic stress during heterologous expression.

  • Co-expression strategies: Introducing molecular chaperones (GroEL/GroES or DnaK/DnaJ/GrpE systems) or other GET pathway components can facilitate proper folding and complex formation.

The effectiveness of these approaches varies between proteins, so researchers should systematically evaluate combinations through small-scale expression tests before scaling up. Solubility can be assessed through Western blot analysis of supernatant and pellet fractions after gentle detergent solubilization .

What controls are essential when studying get1 function in vitro?

Robust experimental design for studying get1 function requires several critical controls to ensure data reliability and interpretability. Researchers should implement:

  • Negative protein controls: Including both unrelated membrane proteins processed identically to get1 and denatured get1 preparations to distinguish specific from non-specific effects.

  • Activity validation controls: When studying membrane insertion activity, researchers should include well-characterized tail-anchored proteins (such as cytochrome b5) as positive substrates, alongside non-tail-anchored membrane proteins as negative substrates.

  • Reconstitution system controls: For liposome-based assays, control experiments should test protein insertion in the absence of get1 and with liposomes of varying lipid compositions to assess the contribution of spontaneous insertion.

  • Binding specificity controls: For interaction studies, both specific competitors (peptides derived from interaction interfaces) and non-specific competitors (unrelated peptides of similar physicochemical properties) should be included.

  • Enzymatic controls: When studying ATPase activity of associated GET components, include samples with non-hydrolyzable ATP analogs and samples lacking tail-anchored substrates.

These controls help distinguish genuine get1-mediated effects from experimental artifacts and provide necessary benchmarks for quantitative analysis. All control experiments should be performed under identical conditions to the main experimental samples, with multiple biological replicates to ensure reproducibility .

How can researchers validate antibodies against get1 for immunological applications?

Developing and validating antibodies against get1 requires systematic evaluation to ensure specificity and sensitivity in the intended applications. The validation process should include:

  • Initial characterization using recombinant protein: Testing antibody recognition of purified get1 protein by Western blot and ELISA, with titration to determine optimal working concentrations and detection limits .

  • Specificity verification: Conducting pre-adsorption tests with the immunizing antigen to confirm signal elimination, and testing against recombinant fragments to map epitope regions.

  • Cross-reactivity assessment: Evaluating potential cross-reactivity with related GET pathway proteins, particularly those with similar transmembrane domains.

  • Cellular validation: Confirming antibody specificity in cellular contexts using:

    • Wild-type vs. get1 knockout or knockdown samples

    • Overexpression systems with epitope-tagged get1 (detecting with both anti-tag and anti-get1 antibodies)

    • Immunofluorescence co-localization with established ER markers

  • Application-specific validation: For each intended application (Western blot, immunoprecipitation, immunofluorescence), specific validation experiments should be performed with appropriate positive and negative controls.

The validation data should be systematically documented, including information about antibody type (polyclonal or monoclonal), immunogen sequence, and optimal conditions for each application. Researchers should be particularly cautious with commercial antibodies, requesting validation data specific to Aspergillus clavatus get1 or closely related fungal homologs .

How can cryo-EM be applied to study the structure and function of get1?

Cryo-electron microscopy (cryo-EM) represents a powerful approach for elucidating the structure of membrane proteins like get1, particularly within larger complexes. Researchers interested in applying cryo-EM to get1 should consider the following methodological approach:

  • Sample preparation optimization: get1 should be purified in detergent or reconstituted into nanodiscs or other membrane mimetics that maintain native structure while providing contrast for imaging. Detergent screening is critical, with LMNG, GDN, or MNG-3 often providing better results than traditional detergents like DDM for cryo-EM applications.

  • Complex formation: Rather than studying get1 in isolation, researchers should focus on reconstituting the functional GET complex, including get1, get2 (or their homologs), and get3 loaded with substrate. This improves particle size for imaging and captures functionally relevant conformations.

  • Data collection strategy: For smaller complexes (<200 kDa), the latest generation of direct electron detectors and energy filters are essential for achieving sufficient resolution. Data collection should employ beam-tilt strategies to overcome preferred orientation issues common with membrane proteins.

  • Computational processing: Extensive classification approaches will likely be necessary to sort conformational heterogeneity, particularly if capturing different states of the translocation process. Focused refinement on the get1 transmembrane domain may improve local resolution in this region.

This approach could reveal the molecular mechanism of tail-anchored protein insertion, including conformational changes during the insertion process, substrate binding sites, and the structural basis for get1-get2-get3 interactions .

What are emerging approaches for studying get1 dynamics in living cells?

Advanced imaging and molecular techniques are enabling unprecedented insights into get1 dynamics within living cells. Researchers interested in this area should consider implementing:

  • Advanced fluorescence microscopy: Techniques such as single-molecule tracking can reveal the diffusional behavior of get1 within the ER membrane, while Fluorescence Recovery After Photobleaching (FRAP) can assess mobile vs. immobile fractions. These approaches require careful design of minimally disruptive fluorescent protein fusions or implementation of self-labeling tags like SNAP or Halo.

  • Super-resolution imaging: STORM, PALM, or MINFLUX microscopy can reveal nanoscale organization of get1 within the ER, potentially identifying specialized insertion domains or colocalization with other machinery. These techniques require appropriate photoconvertible fluorescent proteins or dyes compatible with the fungal cell wall.

  • Optogenetic control systems: Implementing light-controlled dimerization or conformational changes in get1 or its interaction partners allows precise temporal control over protein function, enabling dissection of specific steps in the insertion pathway.

  • Biosensors for real-time activity monitoring: Developing FRET-based reporters that respond to successful membrane insertion events could allow quantitative assessment of get1 function under various conditions or genetic backgrounds.

These approaches can be combined with genetic perturbations (CRISPR-based modifications) or pharmacological interventions to comprehensively map the determinants of get1 function in vivo. The significant challenge in Aspergillus systems lies in adapting these predominantly mammalian cell-based techniques to accommodate the fungal cell wall and hyphal growth pattern .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.