Recombinant Aspergillus clavatus Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Shipped with Ice Packs
In Stock

Description

Introduction and Overview

Recombinant Aspergillus clavatus Vacuolar ATPase assembly integral membrane protein VMA21 (vma21) is a recombinantly expressed protein used in structural and functional studies of the vacuolar ATPase (V-ATPase). V-ATPases are proton pumps essential for acidifying cellular compartments, such as lysosomes and vacuoles, and are critical for processes like protein degradation, nutrient uptake, and cellular pH regulation. The VMA21 protein is a conserved assembly factor that facilitates the proper assembly of the V-ATPase’s membrane-integrated V₀ domain in fungi and other organisms.

Production and Purification

The recombinant Aspergillus clavatus VMA21 is produced in heterologous systems like E. coli or yeast for biochemical and structural studies. Key production specifications include:

ParameterDetailSource
Host SystemsE. coli, yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE confirmed)
Storage BufferTris-based buffer with 50% glycerol (pH 8.0)
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with glycerol for long-term storage
TagNot specified; depends on expression system (e.g., GST, His-tag)

The protein is typically lyophilized or stored in liquid form at −20°C/−80°C to maintain stability.

Clinical and Pathological Relevance

While the Aspergillus clavatus VMA21 is not directly implicated in human disease, mutations in orthologs (e.g., human VMA21) cause X-linked myopathy with excessive autophagy (XMEA) and congenital disorders of glycosylation (CDG). These diseases highlight the importance of VMA21 in maintaining lysosomal function and cellular homeostasis .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
vma21; ACLA_036390; Vacuolar ATPase assembly integral membrane protein vma21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
Target Names
vma21
Target Protein Sequence
MAGRHSQEKSYAEAAAAPAPEKPDSSDVTPAVPADVIYKLLGFTAAMIVGPIGMYFVTVD FGASSTVAGVTAAVTANVILFTYIYVAWLEDKEDREVAAKRKEKKAQ
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum. This complex plays a crucial role in maintaining cellular pH balance and other cellular processes.
Database Links
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is VMA21 and what is its fundamental cellular function?

VMA21 functions as an essential assembly chaperone of the vacuolar ATPase (V-ATPase), the principal proton pump complex in eukaryotic cells. This highly conserved protein facilitates the proper assembly of V-ATPase components, ensuring correct formation of this critical enzyme complex. VMA21's primary role involves chaperoning V-ATPase assembly, which is necessary for lysosomal acidification and proper cellular degradation pathways . The protein is relatively small, comprising 107 amino acids in Aspergillus terreus, and contains transmembrane domains that anchor it to cellular membranes during its chaperone function .

What expression systems are most effective for producing recombinant VMA21 protein?

The most effective expression system documented for recombinant VMA21 production is E. coli. For instance, full-length Aspergillus terreus VMA21 (amino acids 1-107) has been successfully expressed in E. coli with an N-terminal His-tag . When expressing VMA21, researchers should consider optimal codon usage adaptation for the expression host to maximize protein yield. Additionally, the hydrophobic nature of this integral membrane protein often necessitates specialized solubilization and purification strategies to maintain native conformation and biological activity.

What purification methods yield the highest quality recombinant VMA21 protein?

High-quality VMA21 purification typically involves affinity chromatography using the protein's N-terminal His-tag, followed by size exclusion chromatography to enhance purity. The purified protein can achieve greater than 90% homogeneity as determined by SDS-PAGE analysis . Due to its membrane-associated nature, detergent selection is critical during purification. Researchers should avoid repeated freeze-thaw cycles, as they can compromise protein integrity; instead, working aliquots should be stored at 4°C for short-term use (up to one week) . For reconstitution, deionized sterile water is recommended to achieve a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C .

What animal models are available for studying VMA21 function and pathology?

The zebrafish (Danio rerio) represents a well-characterized animal model for studying VMA21 function and associated pathologies. Researchers have successfully generated CRISPR-Cas9 engineered zebrafish with loss-of-function mutations in the VMA21 gene. Two specific mutant lines have been established: one harboring a 1 base pair deletion causing a frameshift mutation (vma21Δ1/Δ1) and another with a 14 bp deletion and 21 bp insertion introducing a premature stop codon (vma21Δ14ins21) . These zebrafish models display phenotypes that recapitulate key features of human VMA21-associated disorders, including impaired motor function, reduced survival, liver dysfunction, and dysregulated autophagy characterized by lysosomal de-acidification and autophagic vacuoles in muscle fibers .

How can VMA21 knockout/knockdown systems be verified for experimental validity?

Verification of VMA21 knockout or knockdown systems requires multiple complementary approaches to ensure experimental validity. Western blot analysis using VMA21-specific antibodies is essential to confirm decreased protein expression levels compared to wild-type and heterozygous controls . Functional validation should include assessment of V-ATPase activity, which can be performed using lysosomal pH assays such as LysoTracker staining. In zebrafish models, phenotypic validation includes morphological assessment (pigmentation, size, swim bladder inflation), behavioral analysis (touch-evoked escape response, swimming patterns), and survival analysis using Kaplan-Meier methods . Molecular signatures of VMA21 deficiency, such as altered LC3I/II ratios indicating disrupted autophagy flux, provide additional verification parameters .

What techniques are most reliable for assessing V-ATPase function in VMA21 research?

The most reliable techniques for assessing V-ATPase function in VMA21 research include:

  • Lysosomal pH measurement using LysoTracker Red staining, which reveals acidified compartments within cells

  • Immunofluorescence analysis of lysosomal markers such as Lamp1 to assess lysosomal biogenesis and distribution

  • Electron microscopy to visualize characteristic autophagic vacuoles with electron-dense material and naked membranes within vacuole walls

  • Western blot analysis of autophagy markers including LC3I, LC3II, and calculation of the LC3II/LC3I ratio to evaluate autophagic flux

  • Fluorescent reporter constructs such as pTol2 (Ubbi:GFP-LC3-RFP-LC3ΔG) that enable direct visualization of autophagic flux through GFP:RFP ratio analysis

These complementary approaches provide robust assessment of V-ATPase function and downstream effects of VMA21 deficiency.

How can researchers distinguish between primary VMA21 dysfunction and secondary cellular responses?

Distinguishing between primary VMA21 dysfunction and secondary cellular responses requires temporal analysis and pathway-specific interventions. In primary VMA21 dysfunction, the immediate consequence is impaired V-ATPase assembly leading to elevated lysosomal pH. This can be measured directly using pH-sensitive dyes or LysoTracker staining. Secondary responses involve disrupted autophagy, altered amino acid levels, and mTORC1 pathway downregulation .

To differentiate these processes, researchers should:

  • Establish a temporal sequence of events following VMA21 deficiency

  • Use chemical modulators that target specific steps in the pathway (e.g., V-ATPase inhibitors like bafilomycin A1 versus autophagy modulators like edaravone or LY294002)

  • Perform rescue experiments with wild-type VMA21 to confirm which phenotypes are directly attributed to VMA21 deficiency

  • Employ tissue-specific or inducible knockout/knockdown systems to distinguish systemic from cell-autonomous effects

How does VMA21 deficiency lead to X-linked myopathy with excessive autophagy (XMEA)?

VMA21 deficiency leads to X-linked myopathy with excessive autophagy (XMEA) through a cascade of cellular events:

  • Reduced VMA21 expression impairs V-ATPase assembly, leading to decreased V-ATPase activity

  • Decreased V-ATPase activity causes elevated lysosomal pH, reducing lysosomal degradative capacity

  • Impaired lysosomal function blocks completion of autophagy, leading to accumulation of undegraded material

  • Reduced degradation decreases available free amino acids in the cell

  • Amino acid deficiency downregulates the mTORC1 pathway, which normally suppresses autophagy

  • Downregulated mTORC1 triggers increased macroautophagy (an overcompensation mechanism)

  • The combination of increased autophagosome formation and decreased lysosomal degradation results in accumulation and fusion of autophagosomes into large, ineffective autolysosomes

  • These autolysosomes engulf sections of cytoplasm, merge, and eventually vacuolate the cell

  • Progressive vacuolation leads to muscle fiber damage and atrophy

This represents a novel mechanism of disease where macroautophagic overcompensation leads to cellular vacuolation and tissue atrophy .

What are the histopathological hallmarks of VMA21-associated muscle disorders?

The histopathological hallmarks of VMA21-associated muscle disorders include:

  • Presence of characteristic autophagic vacuoles with electron-dense material and naked membranes within vacuole walls in muscle fibers

  • In human XMEA cases, vacuoles with sarcolemmal features and multilayered basal membranes (observed in approximately 60% of cases)

  • Reduced lysosomal marker staining (e.g., Lamp1) within myofibers, indicating disrupted lysosomal biogenesis

  • Abnormal accumulation of LC3-positive structures reflecting impaired autophagic flux

  • Progressive muscle fiber atrophy and degeneration

  • In severe cases, complete muscle fiber destruction

These features reflect the underlying pathophysiology of impaired lysosomal function and dysregulated autophagy resulting from VMA21 deficiency.

How does VMA21 interact with other components of the V-ATPase assembly machinery?

VMA21 serves as a dedicated assembly chaperone for the V-ATPase complex, with interactions that are critical for proper V-ATPase formation. While the search results don't provide specific molecular details of these interactions, based on its yeast ortholog Vma21p, VMA21 likely interacts directly with subunits of the V0 domain of V-ATPase during assembly in the endoplasmic reticulum. These interactions facilitate the correct folding and assembly of V-ATPase components before their transport to target membranes. The N-terminal region of VMA21 contains transmembrane domains that are likely involved in these protein-protein interactions . Further research using techniques such as co-immunoprecipitation, proximity labeling, or cross-linking mass spectrometry would help elucidate the specific molecular interactions of VMA21 with V-ATPase components.

What therapeutic strategies show promise for VMA21-associated disorders?

Emerging therapeutic strategies for VMA21-associated disorders focus on modulating autophagy pathways to mitigate disease progression. In zebrafish VMA21 mutant models, two compounds have shown particular promise:

  • Edaravone: This compound improved multiple aspects of the VMA21-deficient phenotype, including muscle birefringence, motor function, and survival. The mechanism may involve antioxidant properties that help mitigate secondary damage from dysregulated autophagy.

  • LY294002: This PI3K inhibitor also demonstrated beneficial effects across multiple domains of the disease phenotype in zebrafish models .

Both compounds appear to function as autophagy modulators, supporting the central role of dysregulated autophagy in disease pathogenesis. Notably, these compounds improved muscle phenotypes but did not resolve liver pathology, suggesting tissue-specific pathomechanisms that may require different therapeutic approaches . It's important to note that some autophagy modulators (particularly wortmannin) worsened the VMA21 mutant phenotype, indicating that careful selection of therapeutic agents is crucial .

What are the major challenges in purifying and maintaining stable recombinant VMA21 protein?

Major challenges in purifying and maintaining stable recombinant VMA21 protein include:

  • Membrane protein solubilization: As an integral membrane protein, VMA21 requires careful detergent selection for effective solubilization without denaturing the protein.

  • Maintaining native conformation: The transmembrane domains of VMA21 are critical for its function but can cause aggregation or misfolding during purification.

  • Protein stability: Recombinant VMA21 is sensitive to repeated freeze-thaw cycles, necessitating careful storage protocols. Working aliquots should be stored at 4°C for up to one week, while long-term storage requires addition of 5-50% glycerol at -20°C/-80°C .

  • Reconstitution conditions: Optimal reconstitution requires deionized sterile water to achieve 0.1-1.0 mg/mL concentration. Brief centrifugation prior to opening is recommended to bring contents to the bottom of the vial .

  • Expression system limitations: While E. coli systems have been successful for production, eukaryotic expression systems might better preserve post-translational modifications and native folding but present their own technical challenges.

How can researchers best model organ-specific effects of VMA21 deficiency?

Researchers can best model organ-specific effects of VMA21 deficiency through:

  • Tissue-specific knockout models: Using Cre-lox or similar systems to generate tissue-specific VMA21 deficiency can help isolate effects in muscles versus other organs like liver.

  • Organ-specific phenotyping: The zebrafish VMA21 model demonstrates distinct phenotypes in muscle (motor impairment) and liver (hepatic steatosis, smaller liver size, impaired bile flux), necessitating organ-specific assessment methods .

  • Complementary in vitro systems: Primary cell cultures or organoids derived from affected tissues can provide controlled environments for studying tissue-specific effects.

  • Differential therapeutic responses: Testing compounds across multiple organ systems reveals tissue-specific responses - compounds that improved muscle phenotypes in zebrafish VMA21 mutants failed to resolve liver pathology, suggesting distinct mechanisms .

  • Age-dependent analysis: The severity and presentation of phenotypes may vary with developmental stage and age, requiring longitudinal assessment to fully characterize organ-specific manifestations.

What emerging technologies might enhance our understanding of VMA21 function?

Emerging technologies that could enhance our understanding of VMA21 function include:

  • Cryo-electron microscopy: This could reveal detailed structural insights into VMA21's interactions with V-ATPase components during assembly.

  • Single-cell transcriptomics and proteomics: These approaches could identify cell-type specific responses to VMA21 deficiency and reveal compensatory mechanisms.

  • Live-cell pH sensors: Advanced fluorescent probes with improved sensitivity could provide real-time monitoring of subcellular pH changes resulting from VMA21 dysfunction.

  • CRISPR-based screening: Genome-wide CRISPR screens could identify genetic modifiers that enhance or suppress VMA21-deficient phenotypes.

  • Tissue-on-chip technology: These systems could allow controlled manipulation of VMA21 expression in human tissue environments, bridging the gap between animal models and human disease.

  • Expanded drug screening platforms: High-throughput screening of larger compound libraries in VMA21-deficient models could identify more effective therapeutic candidates beyond the initial findings with edaravone and LY294002 .

How might understanding VMA21 pathomechanisms inform therapeutic approaches for other lysosomal disorders?

Understanding VMA21 pathomechanisms provides valuable insights that could inform therapeutic approaches for other lysosomal disorders through several mechanisms:

  • Autophagy modulation as a therapeutic strategy: The finding that certain autophagy modulators (edaravone, LY294002) improve VMA21-deficient phenotypes suggests similar approaches might benefit other disorders characterized by dysregulated autophagy .

  • Lysosomal pH restoration: Strategies to normalize lysosomal pH in VMA21 deficiency might be applicable to other disorders where lysosomal acidification is compromised.

  • Tissue-specific interventions: The differential response of muscle versus liver tissue in VMA21 deficiency highlights the need for tissue-tailored therapeutic approaches in lysosomal disorders with multi-system involvement .

  • mTORC1 pathway targeting: Since VMA21 deficiency affects the mTORC1 pathway, therapeutic manipulation of this pathway might be relevant for other lysosomal disorders where nutrient sensing is disrupted .

  • Caution in pathway manipulation: The observation that some autophagy modulators (wortmannin) worsen VMA21-deficient phenotypes underscores the need for careful pathway analysis before therapeutic intervention in any lysosomal disorder .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.