Recombinant Aspergillus flavus Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
rcf1; aim31; AFLA_111660; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167)
Target Names
rcf1
Target Protein Sequence
MSSDPVPSSFEGNPQFEEETSLQKFRRRLKEEPLIPLGCAATSYALYRAYRSMKAGDSVE MNRMFRARIYAQFFTLIAVVVGGMYFKTERQQRKEFERMVEERKSQEKRDAWLRELEIRD KEDKDWRQRHAAMEAAAAEAGKKTAPHDAARSAIERSEEKSIGVLDAVKELLSRRN
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

Advanced Research Questions

  • How can researchers effectively generate and verify aim31 knockout mutants in A. flavus?

    Creating aim31 knockout mutants in A. flavus requires specialized methodologies:

    1. Gene targeting strategy: Either use homologous recombination or CRISPR-Cas9 systems. The most efficient approach involves:

      • Amplifying ~1 kb flanking regions upstream and downstream of aim31

      • Fusion PCR with a selectable marker gene (e.g., pyrithiamine resistance gene ptr)

      • Transformation into A. flavus using PEG-mediated protoplast transformation

    2. Verification methods:

      • PCR verification using primers spanning deletion junctions

      • Southern blot hybridization to confirm proper integration

      • RT-PCR to verify absence of transcript

      • Western blot analysis for protein absence

    3. Phenotypic characterization:

      • Mitochondrial morphology using fluorescent microscopy

      • Growth rate comparisons on different media

      • Stress response assays (oxidative, cell wall, osmotic stressors)

    Studies show that A. flavus mutants should be subjected to multiple generations of screening to ensure stability before phenotypic analysis .

  • What is the role of aim31 in mitochondrial dynamics during A. flavus pathogenesis?

    While specific data on aim31 is limited, research on mitochondrial proteins in A. flavus suggests important roles during pathogenesis:

    1. Host invasion phase: Mitochondrial dynamics change significantly during host invasion, with proteins like aim31 potentially mediating:

      • Energy metabolism shifts during initial colonization

      • Resistance to host-derived oxidative stress

      • Cellular adaptations required for adhesion to host surfaces

    2. Colonization phase: During tissue colonization, mitochondrial proteins may influence:

      • Production of virulence factors including proteases and lipases

      • Cell wall composition and integrity

      • Tolerance to environmental stresses

    Experimental approaches to study these dynamics include:

    • Real-time imaging of fluorescently tagged aim31 during infection models

    • Transcriptomic and proteomic analyses comparing expression between saprophytic and pathogenic growth

    • Infection models using Galleria mellonella larvae or plant seeds to assess virulence differences

  • How does aim31 function intersect with RNA interference mechanisms in A. flavus?

    Recent studies on RNA interference (RNAi) in A. flavus reveal complex regulatory networks that may interact with mitochondrial proteins:

    1. Virus-induced RNAi responses: When A. flavus is infected with mycovirus AfPV1, expression of RNAi components is significantly altered . Mitochondrial proteins like aim31 may be involved in:

      • Viral recognition pathways

      • Signal transduction leading to RNAi activation

      • Mitochondrial adaptations during viral stress

    2. Experimental evidence for RNAi-mitochondria connections:

      • Small RNA sequencing analyses show that viral infection reduces the number of unique sRNA reads in A. flavus

      • GO term and KEGG pathway analyses reveal that functions of sRNA affected by viral infection are closely related to vacuole production

      • Mitochondrial proteins are often implicated in these pathways

    This relationship between RNAi and mitochondrial function represents an emerging research area for understanding fungal adaptation to environmental stresses.

  • How do genetic diversity and recombination in A. flavus populations affect aim31 structure and function?

    A. flavus populations exhibit significant genetic diversity that affects protein functions:

    1. Population structure impact:

      • A. flavus is divided into distinct genetic lineages (IB and IC)

      • These lineages show different levels of aflatoxin production and virulence traits

      • Proteins like aim31 may show lineage-specific variations affecting function

    2. Recombination effects:

      • Evidence of sexual reproduction and recombination exists in A. flavus populations

      • Analysis of mating-type loci (MAT1-1 and MAT1-2) frequencies suggests ongoing recombination

      • This genetic exchange may create novel aim31 variants with altered functions

    3. Biocontrol implications:

      • Commercial biocontrol strains like Afla-Guard and AF36 influence indigenous A. flavus populations

      • These shifts could alter the prevalence of different aim31 variants in agricultural settings

      • Understanding protein variations is important for predicting biocontrol effectiveness

Methodological Research Questions

  • What are the optimal purification strategies for recombinant aim31 protein?

    Purifying recombinant aim31 requires specialized techniques due to its mitochondrial membrane association:

    1. Extraction methods:

      • Gentle cell lysis using glass beads or enzymatic methods

      • Differential centrifugation to isolate mitochondrial fraction

      • Detergent solubilization (e.g., n-dodecyl β-D-maltoside or CHAPS)

    2. Purification workflow:

      • Immobilized metal affinity chromatography (IMAC) using His-tag

      • Ion exchange chromatography for further purification

      • Size exclusion chromatography as a final polishing step

    3. Quality control metrics:

      • SDS-PAGE with Western blotting

      • Mass spectrometry for identity confirmation

      • Circular dichroism for secondary structure verification

      • Dynamic light scattering for aggregation assessment

    These methods should be optimized based on the specific experimental requirements and downstream applications.

  • What assays can be used to measure aim31 activity and interactions?

    Functional characterization of aim31 can employ several complementary approaches:

    1. Interaction studies:

      • Yeast two-hybrid screening to identify protein partners

      • Co-immunoprecipitation followed by mass spectrometry

      • Proximity labeling methods (BioID or APEX) in living cells

      • Fluorescence resonance energy transfer (FRET) for direct interactions

    2. Functional assays:

      • Mitochondrial membrane potential measurements

      • Mitochondrial morphology analysis

      • Protein import assays using isolated mitochondria

      • Lipid binding assays if membrane interactions are suspected

    3. Structural studies:

      • X-ray crystallography (challenging for membrane proteins)

      • Cryo-electron microscopy for structure determination

      • NMR for dynamic studies of protein domains

    These methodologies should be adapted based on specific research questions and available resources.

  • How should environmental factors be controlled when studying aim31 in A. flavus experimental systems?

    Environmental conditions significantly impact A. flavus biology and should be carefully controlled:

    1. Temperature considerations:

      • A. flavus growth is optimal at 30°C but can occur from 15-40°C

      • Temperature significantly affects aflatoxin production, with optimal production at 20-25°C

      • Experiments should maintain consistent temperature with ±0.5°C precision

    2. Media composition:

      • Standard media include Potato Dextrose Agar (PDA) and Corn Meal Medium (CMM)

      • Carbon source affects mitochondrial protein expression

      • Defined minimal media may provide more reproducible results for protein studies

    3. Humidity and light cycles:

      • 12h light/12h dark photoperiod is standard for most studies

      • Humidity should be maintained at 80-85% for optimal growth

      • Specialized incubators with humidity control are recommended

    4. Stress conditions:

      • Cell wall stress (e.g., Congo Red)

      • Osmotic stress (e.g., NaCl, sorbitol)

      • Oxidative stress (e.g., H₂O₂)

      • Genotoxic stress

    Environmental parameters should be reported in detail to ensure experimental reproducibility.

  • What are the best experimental models for studying aim31's role in A. flavus pathogenesis?

    Several experimental systems can be employed to study aim31's role in pathogenesis:

    1. In vitro models:

      • Immortalized human lung epithelial cells

      • Human alveolar macrophage cell lines

      • 3D organoid cultures of respiratory epithelium

    2. Plant infection models:

      • Peanut seed infection assay

      • Maize kernel colonization

      • Cotton bolls

    3. Animal models:

      • Galleria mellonella (wax moth) larvae

      • Mouse pulmonary aspergillosis models

      • Zebrafish embryo infection system

    4. Conditions to assess:

      ParameterMeasurement MethodExpected Outcome for aim31 Mutants
      AdhesionQuantitative adherence assaysPotentially reduced adhesion to surfaces
      InvasionHistopathological analysisAltered invasion patterns
      Stress toleranceGrowth on stress mediaChanged response to oxidative/cell wall stress
      Virulence factorsEnzymatic assaysModified protease/lipase activities

    The choice of model depends on the specific aspect of pathogenesis being investigated.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.