Recombinant Aspergillus flavus High osmolarity signaling protein sho1 (sho1)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

Sho1 is a 311-amino-acid transmembrane protein (UniProt ID: B8NEM4) that activates the High Osmolarity Glycerol (HOG) Mitogen-Activated Protein Kinase (MAPK) pathway in Aspergillus flavus . It detects extracellular osmotic changes and triggers adaptive responses, including glycerol synthesis and oxidative stress resistance . The recombinant form is produced in Escherichia coli with an N-terminal His tag for purification .

Role in Stress Adaptation

Sho1 regulates the HOG-MAPK pathway, which coordinates:

  • Osmotic Stress Response: Activates downstream kinases (e.g., Pbs2, Hog1) to accumulate glycerol and maintain cellular turgor .

  • Oxidative Stress Resistance: Links oxidative stress to morphogenesis and cell wall integrity, as observed in Candida albicans and Aspergillus fumigatus homologs .

Interacting Partners

STRING database analysis identified key interactors :

Protein (Gene ID)FunctionInteraction Score
AFLA_083380 (Pbs2)MAP kinase kinase0.994
AFLA_048880 (Ste11)MAP kinase kinase kinase0.968
AFLA_099500 (Hog1)Mitogen-activated protein kinase0.942

Biotechnological Use

  • Expression Systems: Produced in E. coli with >90% purity (SDS-PAGE verified) .

  • Storage: Lyophilized powder stable at -80°C; reconstituted in Tris/PBS buffer with trehalose .

Disease Relevance

  • Pathogenesis: Sho1 homologs in A. fumigatus influence virulence and sporulation, suggesting a potential role in A. flavus infections .

  • Aflatoxin Production: While A. flavus Sho1’s direct link to aflatoxin biosynthesis remains unconfirmed, proteomic studies highlight stress-response proteins as modulators of toxin yield .

Comparative Analysis of Recombinant Sho1 Proteins

FeatureA. flavus Sho1 A. clavatus Sho1 S. cerevisiae Sho1
SpeciesAspergillus flavusAspergillus clavatusSaccharomyces cerevisiae
Length (aa)311292367
Expression HostE. coliE. coliE. coli
TagHis tagHis tagHis tag
Purity>90%>90%>90%

Future Directions

  • Mechanistic Studies: Elucidate Sho1’s role in A. flavus pathogenicity and aflatoxin regulation .

  • Therapeutic Targeting: Explore Sho1 as a drug target to disrupt fungal stress adaptation .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you require a specific format, kindly indicate your preference in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance for arrangements. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note: The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
sho1; AFLA_062220; High osmolarity signaling protein sho1; Osmosensor sho1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167)
Target Names
sho1
Target Protein Sequence
MVAYSTPSSSLHKPSPYNESRRMARFRPSNILGDPFALATISISILAWVIAFISSIVSAI NARGYPTYSWWGVAYSLCIILGMTAVFGTDTGSVYGVAIVGYLSAGMVITTLGVNSLVYR SDSASQAAGAGFILMSMVIVIWIFYFGSTPQASHRGFIDSFALQKEHPGAYGNGRPMSTA FGNRPETTSSQAPQMYTSAQLNGFETSSPVSGYPGGAPGSENRSSSQPRFGNPSNANLTA NGNENEVPQPTEYPYRAKAIYSYDANPEDANEISFTKHEILEVSDVSGRWWQARKSNGDT GIAPSNYLILL
Uniprot No.

Target Background

Function
This protein serves as a plasma membrane osmosensor, activating the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of Sho1 protein in Aspergillus flavus?

Sho1 in A. flavus likely functions similarly to its homologs in other fungi as an adaptor protein in the HOG-MAPK signaling pathway. Based on studies in related Aspergillus species, Sho1 serves as a sensor protein that detects environmental stresses, particularly osmotic and oxidative stress, and transmits signals to downstream MAPK cascade components. This leads to adaptive responses including altered gene expression, morphological changes, and stress adaptation. In A. fumigatus, Sho1 has been shown to regulate growth, morphology, and oxidant adaptation, suggesting similar roles in A. flavus . The protein likely contains transmembrane domains and a cytoplasmic SH3 domain that facilitates protein-protein interactions with components of the MAPK pathway.

How does Sho1 signaling differ between A. flavus and other Aspergillus species?

While the core functions of Sho1 are likely conserved across Aspergillus species, there may be significant species-specific and strain-specific variations. A. flavus shows extensive strain heterogeneity in infection-relevant traits compared to its close relatives , which may extend to Sho1 signaling pathways. Unlike A. fumigatus, where Sho1 plays a clear role in oxidative stress adaptation , the specific stress responses mediated by Sho1 in A. flavus may vary. Additionally, the downstream targets of the HOG-MAPK pathway might differ between species, leading to distinct physiological outcomes. Comparative genomic and functional analyses between A. flavus Sho1 and homologs in other species (such as A. fumigatus and A. oryzae) would be necessary to fully characterize these differences.

What are the recommended methods for isolating and cultivating A. flavus for Sho1 studies?

For isolation and cultivation of A. flavus, the following methodology is recommended:

  • Isolation: A. flavus can be isolated from environmental sources such as soil, plant material, or contaminated foods. For research purposes, using standard type strains from culture collections is preferable for reproducibility.

  • Culture media: A. flavus grows well on potato dextrose agar (PDA-Difco) for maintenance . For experimental cultures, a production medium containing (g/l) 40 malt extract, 20 yeast extract, 2 KH₂PO₄, 2 (NH₄)₂SO₄, 0.3 MgSO₄·7H₂O, and 0.3 CaCl₂·2H₂O with pH adjusted to 7.0 is effective .

  • Growth conditions: Incubate cultures in Erlenmeyer flasks (250 ml) containing 100 ml of production medium on a rotary shaker at 150 rpm and 30±2°C for 72 hours .

  • Monitoring: Regular microscopic examination to ensure culture purity and to observe morphological characteristics. For Sho1 expression studies, specific growth conditions that induce osmotic or oxidative stress may be necessary to observe relevant phenotypes.

What selectable markers are recommended for A. flavus transformation?

Based on techniques developed for related Aspergillus species, several selectable markers can be used for A. flavus transformation:

What genetic engineering strategies are most effective for studying Sho1 function in A. flavus?

Several genetic engineering approaches can be employed to study Sho1 function in A. flavus:

  • Gene deletion: Generating sho1 knockout strains using homologous recombination is fundamental for functional studies. Efficiency can be significantly improved by using strains with deleted non-homologous end-joining (NHEJ) genes such as ku70, ku80, or ligD . These modifications increase the frequency of homologous recombination events.

  • Complementation studies: Reintroducing wild-type or mutated sho1 genes into knockout strains to confirm phenotypes and dissect functional domains of the protein.

  • Domain mutation analysis: Introducing specific mutations in functional domains (like the SH3 domain) to determine their roles in signaling.

  • Promoter replacement: Replacing the native sho1 promoter with inducible or constitutive promoters to control expression levels for phenotypic analysis.

  • Fluorescent protein tagging: Creating Sho1-GFP fusion proteins to track subcellular localization and dynamics, particularly under stress conditions.

  • Interactome analysis: Using techniques like yeast two-hybrid or co-immunoprecipitation to identify protein interaction partners in the signaling cascade.

For transformation, both PEG-mediated protoplast transformation and Agrobacterium tumefaciens-mediated transformation (ATMT) systems can be effective, with ATMT often being simpler to implement and potentially more efficient .

How does strain variation in A. flavus affect Sho1 signaling and function?

A. flavus exhibits extensive strain heterogeneity in infection-relevant genomic, chemical, and phenotypic traits . This variation likely extends to Sho1 signaling pathways, with potential impacts on:

  • Protein sequence variation: Polymorphisms in the sho1 gene between strains may affect protein structure, binding affinities, and signaling efficiency.

  • Expression regulation: Different strains may exhibit varied basal expression levels or different expression patterns in response to environmental stimuli.

  • Pathway component variation: Differences in downstream signaling components of the HOG-MAPK pathway between strains could result in distinct stress responses despite similar Sho1 activity.

  • Phenotypic outcomes: The ultimate physiological and morphological effects of Sho1 signaling may vary between strains due to different genetic backgrounds.

Researchers should characterize Sho1 function across multiple A. flavus strains, particularly comparing clinical isolates with environmental strains, to understand the relationship between strain variation and Sho1 function. Comparative genomic and transcriptomic analyses can help identify strain-specific differences in the HOG-MAPK pathway components.

What methodologies are recommended for analyzing Sho1-mediated stress responses?

To analyze Sho1-mediated stress responses in A. flavus, the following methodological approaches are recommended:

  • Growth assays: Compare wild-type and sho1 mutant strains under various stress conditions (osmotic, oxidative, cell wall, temperature) by measuring colony diameter, biomass accumulation, or growth rate.

  • Microscopic analysis: Examine morphological changes (hyphal growth, conidiation, conidial germination) in response to stress using light, fluorescence, or electron microscopy.

  • Stress survival assays: Assess survival rates following acute stress exposure (e.g., high concentrations of H₂O₂, NaCl, or sorbitol).

  • MAPK phosphorylation analysis: Use Western blotting with phospho-specific antibodies to detect activation of downstream MAPKs (like Hog1p) in response to stress.

  • Transcriptome analysis: Employ RNA-seq to identify genes differentially regulated in sho1 mutants compared to wild-type, particularly under stress conditions.

  • Proteome analysis: Use mass spectrometry-based approaches to identify proteins whose expression or phosphorylation state changes in a Sho1-dependent manner.

  • Metabolome analysis: Analyze changes in cellular metabolites (particularly stress protectants like glycerol) in response to osmotic stress in wild-type and mutant strains.

These approaches should be combined to build a comprehensive understanding of how Sho1 mediates stress responses in A. flavus.

What transformation methods are most efficient for A. flavus genetic manipulation?

Two primary transformation methods are recommended for A. flavus genetic manipulation:

  • PEG-mediated protoplast transformation:

    • Standard but labor-intensive method

    • Requires enzymatic digestion of fungal cell walls to generate protoplasts

    • Transformation efficiency can be variable

    • Protocol includes:
      a) Growing young mycelia in liquid medium
      b) Enzymatic digestion with lysing enzymes
      c) Osmotic stabilization of protoplasts
      d) PEG-mediated DNA uptake
      e) Regeneration on selective media

  • Agrobacterium tumefaciens-mediated transformation (ATMT):

    • Often more efficient and simpler to implement

    • Doesn't require protoplast preparation

    • Uses binary vector system with T-DNA transfer

    • Protocol includes:
      a) Preparation of A. tumefaciens carrying the binary vector
      b) Co-cultivation with fungal conidia
      c) Selection of transformants

For both methods, transformation efficiency can be significantly improved by using NHEJ-deficient recipient strains (Δku70, Δku80, or ΔligD) to favor homologous recombination events . The choice between methods depends on available resources, experience, and specific experimental requirements.

How can homologous recombination efficiency be optimized for sho1 gene targeting?

To optimize homologous recombination efficiency for sho1 gene targeting in A. flavus:

  • Use NHEJ-deficient strains: Generate or obtain A. flavus strains with deleted ku70, ku80, or ligD genes, which can increase homologous recombination efficiency substantially .

  • Design optimal homology arms:

    • Use at least 1-2 kb of homology on each side of the target locus

    • Ensure high sequence identity between the targeting construct and target locus

    • Avoid repetitive sequences in homology regions

  • Optimize transformation conditions:

    • Use freshly prepared protoplasts or competent cells

    • Maintain appropriate osmotic conditions throughout the procedure

    • Use high-quality, linearized DNA constructs

  • Employ split-marker approach: Divide the selection marker into two overlapping fragments, each fused to one homology arm, requiring homologous recombination for marker reconstitution.

  • Screen efficiently: Develop PCR-based screening strategies to quickly identify correct integrants and differentiate them from ectopic integrations.

  • Consider Cre-loxP system: For multiple genetic manipulations, implement Cre-loxP recombination system for marker recycling .

What expression systems are recommended for producing recombinant Sho1 in A. flavus?

For recombinant expression of Sho1 in A. flavus, consider the following expression systems:

  • Native promoter expression: Using the native sho1 promoter maintains natural expression patterns but may result in lower protein yields.

  • Constitutive promoters:

    • The A. nidulans gpdA promoter (glyceraldehyde-3-phosphate dehydrogenase)

    • The tef1 promoter (translation elongation factor)
      These provide strong, consistent expression throughout growth.

  • Inducible promoters:

    • Alcohol-inducible alcA promoter (induced by ethanol or threonine)

    • Xylose-inducible xylP promoter

    • Maltose-inducible amyB promoter
      These allow controlled expression at specific timepoints.

  • Tag selection: Consider adding tags (His, FLAG, HA, GFP) for detection and purification. C-terminal tags are generally preferred as N-terminal tags may interfere with signal peptides or membrane insertion.

  • Integration locus: Select a well-characterized, transcriptionally active genomic locus for integration of expression constructs to ensure consistent expression.

  • Codon optimization: Consider optimizing the codon usage of the sho1 gene if expressing heterologous versions from other species.

  • Secretion signals: If secretion is desired, include appropriate signal peptides, though as a membrane protein, Sho1 is not typically secreted.

Optimization through UV mutagenesis, as demonstrated for other recombinant proteins in A. oryzae , could potentially improve expression levels.

What are common challenges in interpreting Sho1 functional data in A. flavus?

Researchers often encounter several challenges when interpreting functional data for Sho1 in A. flavus:

  • Pleiotropy: Sho1 impacts multiple cellular processes, making it difficult to distinguish direct versus indirect effects. Careful phenotypic characterization under various conditions is essential for comprehensive understanding.

  • Redundancy: Multiple stress-sensing mechanisms may exist, potentially masking the effects of sho1 deletion. Consider generating double or triple mutants of related signaling components to uncover redundant functions.

  • Strain variation: The extensive strain heterogeneity in A. flavus can lead to inconsistent results between labs using different strains. Always clearly report strain information and consider validating key findings in multiple genetic backgrounds.

  • Growth condition specificity: Sho1-dependent phenotypes may only be apparent under specific stress conditions or growth phases. Test a comprehensive range of conditions to fully characterize sho1 function.

  • Cross-talk between signaling pathways: Sho1 may interact with multiple MAPK pathways beyond HOG, complicating interpretation. Use phospho-specific antibodies and genetic approaches to dissect pathway-specific effects.

  • Physiological relevance: In vitro experimental conditions may not accurately reflect the environments A. flavus encounters in nature or during infection. Consider validating findings in relevant infection models.

  • Quantification challenges: Subtle phenotypic effects require robust quantification methods. Implement appropriate statistical analyses and ensure sufficient biological and technical replication.

How can researchers troubleshoot issues with Sho1 expression or function in recombinant systems?

When troubleshooting issues with recombinant Sho1 expression or function:

  • Low expression levels:

    • Verify transcript levels using RT-qPCR

    • Try different promoters or integration loci

    • Consider codon optimization

    • Test UV mutagenesis approaches to isolate hyperproducing strains

  • Protein mislocalization:

    • Confirm proper membrane localization using fluorescent protein fusions

    • Verify signal sequences or transmembrane domains are intact

    • Check if tags interfere with localization and try alternative tagging strategies

  • Loss of function:

    • Ensure critical domains remain intact in fusion constructs

    • Verify protein folding using epitope accessibility or limited proteolysis

    • Test complementation with wild-type sho1 to confirm phenotype specificity

  • Inconsistent phenotypes:

    • Standardize growth conditions rigorously

    • Increase biological replicates

    • Implement quantitative phenotype measurements

    • Consider environmental variables (media batch, incubation conditions)

  • Transformation failures:

    • Check construct integrity before transformation

    • Optimize protoplast quality or ATMT conditions

    • Verify selection marker functionality

    • Try alternative transformation methods

  • Background genetic effects:

    • Use isogenic strains for comparisons

    • Complement mutations in multiple independent transformants

    • Consider whole-genome sequencing to identify unintended mutations

What statistical approaches are best for analyzing strain variation effects on Sho1 function?

To analyze strain variation effects on Sho1 function in A. flavus, the following statistical approaches are recommended:

  • Experimental design considerations:

    • Use balanced designs with equal replication across strains

    • Include appropriate controls (parental strains, marker-only integrants)

    • Plan for sufficient biological and technical replicates

    • Consider blocking factors (experiment date, media batch)

  • Appropriate statistical tests:

    • Analysis of Variance (ANOVA) with post-hoc tests for comparing multiple strains

    • Mixed-effects models to account for random effects and nested designs

    • Non-parametric alternatives (Kruskal-Wallis test) when assumptions are violated

    • Repeated measures ANOVA for time-course experiments

  • Multivariate approaches:

    • Principal Component Analysis (PCA) to examine patterns across multiple phenotypes

    • Hierarchical clustering to identify groups of similar strains

    • MANOVA when multiple dependent variables are analyzed simultaneously

  • Advanced modeling:

    • Regression models to identify relationships between genetic variations and phenotypes

    • Machine learning approaches for complex datasets with many variables

  • Visualization techniques:

    • Heat maps for comparing multiple strains across multiple conditions

    • Interaction plots to visualize strain-by-condition effects

    • Forest plots for meta-analysis across experiments

  • Correction for multiple testing:

    • Bonferroni correction for stringent control of family-wise error rate

    • False Discovery Rate (FDR) approaches like Benjamini-Hochberg procedure

    • Consider hierarchical FDR for grouped hypotheses

This comprehensive statistical approach will allow researchers to robustly analyze how strain variation affects Sho1 function while accounting for the extensive heterogeneity observed in A. flavus .

How does Sho1 function contribute to A. flavus pathogenicity?

Based on studies in related pathogenic fungi, Sho1 likely contributes to A. flavus pathogenicity through several mechanisms:

  • Stress adaptation: As a component of the HOG-MAPK pathway, Sho1 helps A. flavus adapt to stressful conditions encountered during host invasion, including oxidative stress generated by host immune cells . The ability to withstand oxidative stress is crucial for survival within the host environment.

  • Morphological regulation: Sho1 influences fungal morphology and growth patterns , which are important for tissue invasion and colonization. Changes in hyphal development, branching, and conidiation can directly impact virulence.

  • Cell wall integrity: The HOG pathway interacts with cell wall integrity pathways, and Sho1 may play a role in maintaining cell wall structure during host colonization. Proper cell wall composition is essential for evading host recognition and resisting antifungal compounds.

  • Virulence factor regulation: Sho1 signaling may regulate the expression of virulence factors, including toxins and hydrolytic enzymes that facilitate host tissue damage and nutrient acquisition.

  • Host adaptation: A. flavus shows extensive strain variation in infection-relevant traits , and Sho1 may contribute to this variation by differentially regulating adaptive responses in different strains.

To fully understand Sho1's contribution to pathogenicity, researchers should compare virulence between wild-type and sho1 mutant strains in appropriate animal models, examine host-pathogen interactions at the cellular level, and analyze the expression of virulence-associated genes in a Sho1-dependent manner.

What animal models are appropriate for studying Sho1's role in A. flavus virulence?

Several animal models can be used to study Sho1's role in A. flavus virulence:

  • Murine models:

    • Immunocompromised mice (e.g., corticosteroid-treated or neutropenic) for invasive aspergillosis

    • Intranasal or intravenous inoculation routes depending on the research question

    • Parameters to assess: survival rates, fungal burden in organs, histopathology, inflammatory markers

    • These models are considered gold standards for aspergillosis studies

  • Invertebrate models:

    • Galleria mellonella (greater wax moth) larvae

      • Advantages: ethical considerations, cost-effectiveness, room temperature incubation

      • Parameters: survival curves, melanization response, hemocyte counts

    • Drosophila melanogaster (fruit fly)

      • Useful for studying specific aspects of host-pathogen interactions

      • Genetic tools available for manipulating host immunity

    • These models can provide initial virulence assessments before proceeding to mammalian models

  • Cell culture models:

    • Macrophage interaction assays (phagocytosis, fungal survival, cytokine production)

    • Respiratory epithelial cell adhesion and damage assays

    • Neutrophil killing assays

    • These provide mechanistic insights into specific aspects of virulence

  • Organ culture models:

    • Ex vivo lung slice cultures

    • Corneal infection models for fungal keratitis studies

    • These bridge the gap between in vitro and in vivo studies

When designing experiments, researchers should consider:

  • Using multiple models to comprehensively assess virulence

  • Including appropriate controls (parental strains, other relevant mutants)

  • Standardizing inoculum preparation and infection procedures

  • Using sufficient animals to achieve statistical power

  • Implementing appropriate humane endpoints

What emerging technologies may advance Sho1 research in A. flavus?

Several emerging technologies show promise for advancing Sho1 research in A. flavus:

  • CRISPR-Cas9 genome editing:

    • More precise gene editing with fewer off-target effects

    • Multiplexed editing of several genes simultaneously

    • Creation of conditional mutants using inducible CRISPR systems

    • Base editing for introducing specific mutations without double-strand breaks

  • Single-cell technologies:

    • Single-cell RNA-seq to reveal cell-to-cell variability in Sho1 signaling

    • Single-cell proteomics to detect heterogeneity in protein expression and phosphorylation

    • Spatial transcriptomics to map Sho1-dependent gene expression in fungal colonies or during host interaction

  • Advanced imaging techniques:

    • Super-resolution microscopy for detailed localization of Sho1 within cell membranes

    • Live-cell biosensors to monitor HOG pathway activation in real-time

    • Correlative light and electron microscopy to link Sho1 localization with ultrastructural features

  • Protein interaction mapping:

    • Proximity labeling techniques (BioID, APEX) to identify Sho1 interaction partners in vivo

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during signaling

    • Cryo-EM structural studies of Sho1 signaling complexes

  • Systems biology approaches:

    • Multi-omics integration to build comprehensive models of Sho1 signaling networks

    • Machine learning for predicting phenotypic outcomes of genetic variations

    • Network analysis to identify critical nodes in signaling pathways

  • Synthetic biology tools:

    • Engineered signaling circuits to rewire Sho1 responses

    • Optogenetic control of Sho1 signaling for precise temporal activation

    • Biosensors reporting on pathway activation in real-time

These technologies will enable researchers to address fundamental questions about Sho1 function with unprecedented precision and depth.

What are the most significant knowledge gaps in understanding A. flavus Sho1 function?

Despite advances in understanding Sho1 in related fungi, several significant knowledge gaps remain for A. flavus Sho1:

  • Structural features and domains:

    • Detailed structural characterization of A. flavus Sho1

    • Identification of critical functional domains and their interactions

    • Conformational changes during signal transduction

  • Sensing mechanisms:

    • How Sho1 detects different stresses (osmotic, oxidative)

    • Whether Sho1 acts directly as a sensor or requires additional components

    • Mechanisms of signal integration from multiple stresses

  • Signaling specificity:

    • How signal specificity is maintained despite crosstalk between pathways

    • Role of scaffold proteins, interaction kinetics, and spatial organization

    • Differences in signaling between environmental and pathogenic conditions

  • Strain variation impacts:

    • How genetic variation in sho1 and interacting genes affects signaling

    • Correlation between Sho1 variants and virulence potential

    • Evolution of Sho1 signaling in the context of adaptation to different niches

  • Host interaction dynamics:

    • Role of Sho1 in sensing and responding to host environments

    • Potential for host factors to influence Sho1 signaling

    • Temporal dynamics of Sho1 activation during infection progression

  • Therapeutic targeting potential:

    • Druggability of Sho1 or its downstream components

    • Potential for Sho1 pathway inhibitors as antifungal agents

    • Specificity challenges for targeting fungal versus human homologs

Addressing these knowledge gaps will require interdisciplinary approaches combining genetics, biochemistry, structural biology, systems biology, and infection models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.