Recombinant Aspergillus flavus Probable endonuclease lcl3 (lcl3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its inclusion in the production process.
Synonyms
lcl3; AFLA_080100; Probable endonuclease lcl3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167)
Target Names
lcl3
Target Protein Sequence
MRWPPWASESQARDKQDEQNQKNWDKSLNAIDWAAFTEPRTLIPTLILTTGIIGALQIHR RYLRRFPDAVSISPSYFRKRTILGQVTSVGDGDGFRLYHTPGGRLAGWGWLPWKRVPTAK KDLRDKTISVRLAGVDAPELAHFGRPEQPYAREAHEWLTSYVLNRRVRVLVHRQDQYQRV VASAYVRRAIDFPIPFRRRDVSYEMLTRGLATVYEAKAGSEFGGPELERKYREAESIAKR KGTGLWKGYRRNRKGWESPREYKTRMGLEEQSQGKGN
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What genetic diversity exists within Aspergillus flavus populations?

Studies have revealed that A. flavus is not a homogeneous species as once thought. Analysis of 31 Australian isolates demonstrated that A. flavus isolates fall into two reproductively isolated clades (groups I and II). Within group I, the lack of concordance among gene genealogies is consistent with a history of recombination, challenging the previously held notion that the fungus is strictly clonal . Additionally, molecular variation analysis has shown that A. flavus isolates vary in their Internal Transcribed Spacer (ITS) regions, with differences in both the size and number of fragments when subjected to restriction enzyme digestion, confirming the existence of significant genetic variability among isolates .

How is genetic variation in Aspergillus flavus typically analyzed?

Genetic variation in A. flavus is commonly analyzed using PCR-based restriction fragment length polymorphism (RFLP) techniques. The process typically involves:

  • PCR amplification of the internal transcribed spacer (ITS) regions of ribosomal DNA

  • Digestion of amplicons with restriction endonucleases such as EcoRI, HaeIII, and TaqI

  • Analysis of the resulting restriction patterns to identify genetic variability

This approach has proven effective for identifying different strains of A. flavus. In studies examining the ITS region, primers ITS1 and ITS4 typically generate products of approximately 595-600 bp, which can then be subjected to restriction enzyme digestion to reveal polymorphisms . The restriction enzyme HaeIII has been found to be most effective in discriminating between isolates, followed by TaqI and EcoRI.

What evidence exists for recombination in Aspergillus flavus populations despite its asexual reproduction?

Despite being known to reproduce exclusively asexually, evidence suggests that A. flavus may undergo recombination. Analysis of gene genealogies from Australian isolates revealed a lack of concordance among different genes within group I isolates, consistent with a history of recombination . This challenges the traditional assumption of strict clonality in this fungus. The potential for nonsexual recombination appears to exist among isolates that are highly similar, suggesting alternative genetic exchange mechanisms beyond conventional sexual reproduction. This finding has significant implications for understanding the evolution and diversification of A. flavus strains in nature.

How do endonucleases contribute to genetic diversity in fungi like Aspergillus flavus?

Endonucleases play critical roles in genetic recombination and DNA repair processes that contribute to fungal genetic diversity. While specific information on the lcl3 endonuclease is limited in the literature, restriction endonucleases like EcoRI, HaeIII, and TaqI have been used to demonstrate genetic variability among A. flavus isolates by cleaving the ITS regions at specific recognition sequences . The resulting fragment patterns reveal underlying genetic differences. Endogenous endonucleases in fungi may facilitate genetic recombination through processes such as homologous recombination, DNA repair, and potentially horizontal gene transfer, all of which contribute to genetic diversity within populations.

What are the implications of genetic recombination for aflatoxin production in Aspergillus flavus?

Genetic recombination in A. flavus has significant implications for aflatoxin production, which is a complex secondary metabolite phenotype involving multiple genes. Most of the specific enzymatic activities required for aflatoxin production are encoded in a gene cluster, but additional unlinked loci are also required . In natural populations, A. flavus is highly polymorphic, including for aflatoxin production capabilities. The quantity of the carcinogenic metabolite aflatoxin B1 produced by different isolates has been shown to range between 1.9 and 206.6 ng/ml, with the variability suggested to be due to differences in genetic composition . Recombination between strains with different aflatoxin-producing capacities could potentially generate novel phenotypes with altered toxin production profiles.

What experimental design strategies are most effective for differential genetic analysis of Aspergillus flavus isolates?

For effective differential genetic analysis of A. flavus isolates, researchers should consider:

  • Sampling strategy: Include sufficient biological replicates to account for natural variation. Studies demonstrate that increasing the number of biological replicates provides more statistical power for identifying differentially expressed genes (DEGs) .

  • Replication level: The correlation between detected DEGs and the number of biological replicates is almost linear for many analysis tools, though this relationship may vary depending on the biological variation in the samples .

  • Restriction enzyme selection: When using PCR-RFLP for strain identification, HaeIII has been shown to be the most effective in discriminating between isolates, followed by TaqI and EcoRI .

  • Statistical approach: Select appropriate statistical methods based on your data characteristics. For differential expression analysis with limited replicates, tools like edgeR with optimized biological coefficient of variation (BCV) values can be employed .

The table below summarizes recommended minimum replicate numbers for different analysis objectives:

Analysis ObjectiveMinimum ReplicatesOptimal ReplicatesNotes
Basic strain differentiation35Sufficient for initial RFLP analysis
DEG identification3≥5More replicates provide increasing statistical power
Comprehensive population analysis10≥14Required for detecting subtle genetic variation

How can PCR-RFLP be optimized for analyzing genetic variation in Aspergillus flavus?

To optimize PCR-RFLP analysis for A. flavus genetic variation studies:

  • Primer selection: Use established primers such as ITS1 and ITS4, which reliably amplify the ITS region producing a ~595-600 bp fragment in A. flavus .

  • PCR optimization: Perform PCRs using approximately 1 μl of diluted genomic DNA template in 50-μl reactions to ensure sufficient yield .

  • Restriction enzyme selection: Consider using multiple restriction enzymes for comprehensive analysis. HaeIII has been found to be the most effective for discriminating between isolates, followed by TaqI and EcoRI .

  • Fragment analysis: Compare both the size and number of fragments produced after digestion to identify polymorphisms.

  • Comparative analysis: When possible, include reference strains with known characteristics to facilitate interpretation of restriction patterns.

This approach is effective for the identification of different strains and can be particularly valuable in epidemiological studies or investigations of aflatoxin production capability among different isolates.

What statistical approaches are most appropriate for analyzing genetic variation data from Aspergillus flavus studies?

When analyzing genetic variation data from A. flavus studies, consider the following statistical approaches:

  • For differential expression analysis: Tools such as DESeq, edgeR, and Cuffdiff2 can be employed, with performance varying based on the number of biological replicates available. With limited replicates, edgeR with optimized BCV values often performs well .

  • ROC curve analysis: Evaluate true positive rates (TPR) and false positive rates (FPR) to assess the performance of different analytical methods. Two types of area under the curve (AUC) calculations can be used: AUC1 for the full range of FPR (0≤FPR≤1) and AUC2 for a limited range (typically 0≤FPR≤0.1) .

  • Correlation analysis: For population genetics studies, analyze the correlation between genetic distances and geographic or phenotypic measures to identify patterns of dispersal or selection.

  • Mixed methods approaches: For complex research questions, consider linking qualitative and quantitative methodologies to provide more comprehensive insights into genetic variation and its functional implications .

The choice of statistical method should be guided by the specific research question, the amount of biological replication available, and the expected level of variation within the dataset.

How should researchers approach the study of potential endonucleases like lcl3 in Aspergillus flavus?

When studying potential endonucleases in A. flavus, researchers should employ a multi-faceted approach:

  • Genomic identification: Begin with bioinformatic analysis to identify potential endonuclease-encoding genes based on sequence homology with known endonucleases from related fungi.

  • Expression analysis: Use RNA-Seq to determine expression levels under different conditions, employing sufficient biological replicates (minimum 3, optimally 5 or more) to ensure statistical power .

  • Functional characterization: Express the putative endonuclease gene in a heterologous system and assess activity using purified protein and defined substrates.

  • Gene knockout/knockdown: Create mutant strains lacking the endonuclease gene to evaluate its biological function and impact on recombination rates.

  • Population genetics: Examine sequence variation in the endonuclease gene across different A. flavus isolates to assess evolutionary conservation and selection pressure.

This comprehensive approach allows for thorough characterization of novel endonucleases and their potential roles in genetic recombination or DNA metabolism.

What considerations are important when interpreting contradictory data in Aspergillus flavus genetic studies?

When faced with contradictory data in A. flavus genetic studies, researchers should:

By systematically evaluating these factors, researchers can better understand the source of contradictory data and design follow-up experiments to resolve discrepancies.

How does the discovery of recombination in Aspergillus flavus impact biological control strategies?

The discovery of recombination in A. flavus has profound implications for biological control strategies:

  • Challenge to traditional assumptions: Biological control methods currently being tested, including seeding fields with large quantities of natural nontoxigenic strains, either assume that the fungus is clonal or fail to consider the effects of potential outcrossing .

  • Competitive dynamics: Introduced strains must be effective competitors with respect to native strains, but recombination could alter this competitive balance over time.

  • Novel aflatoxin phenotypes: Since aflatoxin production is a polygenic trait involving a gene cluster and additional unlinked loci, outcrossing between introduced nontoxigenic strains and native strains could produce competitive progeny with novel aflatoxin phenotypes .

  • Spread of recombinants: Novel recombinants that emerge from introduced and native strains could potentially spread to new locations, complicating containment efforts.

  • Monitoring requirements: Long-term monitoring of field sites where biocontrol agents have been introduced becomes essential to track potential genetic changes in the population.

These considerations suggest that biological control strategies need to account for the potential of genetic recombination and should include monitoring programs to detect the emergence of novel genotypes with altered phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.