Recombinant Aspergillus niger 3-ketoacyl-CoA reductase (An02g03570)
Description
Introduction to Recombinant Aspergillus niger 3-ketoacyl-CoA Reductase (An02g03570)
Recombinant Aspergillus niger 3-ketoacyl-CoA reductase (An02g03570) is a recombinant protein derived from the fungus Aspergillus niger. This enzyme plays a crucial role in the fatty acid biosynthesis pathway, specifically in the reduction of 3-ketoacyl-CoA to form acyl-CoA, which is an essential step in the elongation of fatty acid chains. The recombinant version of this enzyme is produced through genetic engineering techniques, allowing for its expression in various host organisms for research and industrial applications.
Characteristics of Recombinant Aspergillus niger 3-ketoacyl-CoA Reductase
-
Protein Details: The recombinant 3-ketoacyl-CoA reductase is a full-length protein with an amino acid sequence starting with MDFLTKHLDCLSNWQLNLQPGWQTVGASALLAAGSLFVVSRALVFVRVLLSLFVLPGKPL... and ending with ...KRALRKAEREKGKKST .
-
Expression and Host: It is expressed in Aspergillus niger strain CBS 513.88 / FGSC A1513 .
-
Storage Conditions: The recombinant protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability .
Function and Role in Fatty Acid Biosynthesis
3-ketoacyl-CoA reductase is a key enzyme in the fatty acid synthase complex, responsible for reducing 3-ketoacyl-CoA intermediates to acyl-CoA. This step is crucial for the elongation and synthesis of fatty acids, which are essential components of cellular membranes and energy storage molecules.
Comparison with Other Recombinant Enzymes from Aspergillus niger
| Enzyme | Function | Expression Host | Industrial Applications |
|---|---|---|---|
| Glucose Oxidase | Oxidizes glucose to gluconic acid | Aspergillus niger | Food, pharmaceuticals |
| Lipase | Hydrolyzes triglycerides | Aspergillus niger | Detergents, food processing |
| 3-ketoacyl-CoA Reductase | Reduces 3-ketoacyl-CoA in fatty acid synthesis | Aspergillus niger | Biofuels, nutritional supplements |
References Kinetics of glucose oxidase excretion by recombinant Aspergillus niger. Disrupting enzyme fluidity - eLife. Recombinant Aspergillus niger 3-ketoacyl-CoA reductase. Lipase production by recombinant strains of Aspergillus niger. Biofuel Enzyme Reactions Kit A ThINQ!™ Investigation - Bio-Rad. Recombinant Aspergillus niger Aspergillopepsin-2 - SAB.
Product Specs
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Target Background
Recombinant Aspergillus niger 3-ketoacyl-CoA reductase (An02g03570) is a microsomal membrane-bound enzyme integral to the fatty acid elongation system. It is responsible for producing very-long-chain fatty acids (VLCFAs), specifically 26-carbon VLCFAs, from palmitate. The enzyme catalyzes the reduction of the 3-ketoacyl-CoA intermediate generated in each cycle of fatty acid elongation. These VLCFAs serve as precursors for ceramide and sphingolipids.
KEGG: ang:ANI_1_488024
STRING: 5061.CADANGAP00001813
