Recombinant Aspergillus niger Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Description

Characterization of Recombinant Aspergillus niger AIM31

AIM31 belongs to a conserved protein family involved in mitochondrial dynamics and inheritance. In Aspergillus niger, it is encoded by the gene aim31 (accession A2QI79) and spans 177 amino acids (aa 1–177) . The recombinant version is typically expressed in E. coli with an N-terminal His-tag for purification and detection .

Production and Purification

The recombinant AIM31 protein is synthesized via bacterial expression systems. This approach leverages E. coli’s high-yield protein production capabilities, followed by affinity chromatography to isolate the His-tagged protein . SDS-PAGE analysis confirms purity, though detailed biochemical assays (e.g., Western blotting) are often required to validate functional integrity .

Potential Applications

The recombinant AIM31 protein serves as a tool for:

  1. Genetic Engineering: Studying mitochondrial inheritance mechanisms in A. niger.

  2. Protein-Protein Interactions: Identifying binding partners in mitochondrial networks .

  3. Strain Optimization: Enhancing mitochondrial efficiency for industrial strain development .

Research Gaps and Challenges

  • Lack of Functional Data: No studies explicitly link A. niger AIM31 to specific phenotypes or metabolic pathways.

  • Expression Optimization: While recombinant production is feasible, native expression levels in A. niger are uncharacterized .

  • Off-Target Effects: Potential interactions with non-mitochondrial processes require validation .

Comparative Analysis of AIM31 in Fungi

SpeciesGene IDHost SystemFunction
Aspergillus nigerA2QI79 E. coliMitochondrial inheritance (inferred)
Saccharomyces cerevisiaeYeastMitochondrial dynamics, hypoxia response
Penicillium marneffeiPMAA_094690 E. coliHypoxia-responsive mitochondrial regulation

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rcf1; aim31; An04g02570; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Target Names
rcf1
Target Protein Sequence
MSEPLPSSFEEHPQFQEETSLQKFRRRLKEEPLIPLGCAATSYALYRAYRSMKAGDSVEM NKMFRARIYAQFFTLIAVVAGGMYYGSERKQRREFEQMVEARKSQEKRDAWLRELEIRDK EDRGWRERHAAIEAAANEAANAKKSFPEQDAARSAIEPSEQKSIGVLIAVKELLSRQ
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is Aspergillus niger and what makes it suitable for recombinant protein research?

Aspergillus niger is an asexual saprophytic fungus that grows on dead leaves, stored grain, compost piles, and other decaying vegetation. It belongs to the genus Aspergillus, which contains hundreds of mold species widely distributed in various climates worldwide . Several characteristics make A. niger particularly suitable for recombinant protein research:

First, A. niger demonstrates remarkable environmental adaptability, being highly aerobic and capable of growing under high osmotic pressure. It shows exceptional thermotolerance, thriving in both freezing and very hot conditions . This adaptability allows for flexible experimental conditions in laboratory settings.

Second, despite being primarily classified as asexual (conidial fungi), some Aspergillus members show evidence of temporary classification within Ascomycota, providing interesting genetic diversity for investigation . A. niger produces spores on asexual structures called conidia, which facilitates genetic manipulation and culture propagation.

Third, A. niger has established biotechnological applications through its fermentation capabilities, producing useful enzymes for corn syrup, wine, and cider production . This established history in biotechnology indicates well-developed protocols for cultivation and protein expression.

For research purposes, recombinant A. niger proteins like MED31 are often expressed with histidine tags to facilitate purification and functional characterization in controlled laboratory environments .

How does mitochondrial protein 31 function in normal cellular metabolism?

Mitochondrial protein 31 plays crucial roles in maintaining proper mitochondrial function and cellular metabolism. While specific information about aim31 is limited in the search results, we can draw insights from related mitochondrial protein research.

The importance of properly functioning mitochondrial proteins becomes evident when examining mitochondrial diseases like MELAS (Mitochondrial Encephalomyopathy, Lactic Acidosis, and Stroke-like episodes) syndrome. In such conditions, mutations in mitochondrial DNA (mtDNA) lead to dysfunctional proteins and compromised mitochondrial function .

Properly functioning mitochondrial proteins like aim31 would typically contribute to:

  • Maintaining appropriate mitochondrial DNA copy number

  • Supporting efficient oxidative phosphorylation

  • Facilitating protein import into mitochondria

  • Regulating mitochondrial dynamics (fusion/fission)

  • Coordinating between nuclear and mitochondrial genomes

When these proteins function normally, they help maintain what researchers call "heteroplasmy" - the balance between wild-type (normal) and mutant mitochondrial DNA. The significance of this balance is highlighted in research using targeted nucleases like mitoARCUS, which can eliminate mutant mitochondrial DNA while leaving wild-type mtDNA intact, allowing normal mitochondrial function to be restored .

What experimental systems are used to study recombinant A. niger proteins?

Multiple experimental systems have been developed to study recombinant Aspergillus niger proteins. Based on available research practices, these systems typically include:

Expression Systems:

  • Heterologous expression in bacteria (E. coli)

  • Yeast expression systems (S. cerevisiae, P. pastoris)

  • Native A. niger expression with modification

  • Mammalian cell cultures for functional studies

Analytical Approaches:

  • Protein purification via histidine-tag affinity chromatography

  • Structure determination through X-ray crystallography or NMR

  • Functional assays measuring enzymatic activity

  • Localization studies using fluorescent tagging

When studying mitochondrial proteins specifically, researchers often employ specialized approaches to address the unique challenges of mitochondrial targeting and function. For instance, the development of mitochondrial-targeted nucleases like mitoARCUS demonstrates how specialized experimental systems can be created to target mitochondrial components .

The experimental framework for investigating recombinant A. niger proteins typically follows a systematic workflow similar to the one depicted in this representative data table:

Experimental PhaseTechniquesData FormatExpected VolumeAnalysis Approach
Gene isolationPCR, Sequencing.fasta, .ab110-50 MBSequence alignment
Expression vector constructionRestriction digestion, Ligation.gb, .dna1-5 MBVector maps
Protein expressionSDS-PAGE, Western blot.tiff, .jpg50-200 MBDensitometry
Protein purificationFPLC, Size exclusion.csv, .dat1-5 GBChromatogram analysis
Functional characterizationEnzymatic assays, Binding studies.xlsx, .csv0.5-2 GBKinetic modeling

This systematic approach allows researchers to thoroughly characterize recombinant proteins and their functional properties in controlled experimental settings.

What are the structural characteristics of mitochondrial protein 31 in A. niger?

While specific structural information about mitochondrial protein 31 (aim31) in Aspergillus niger is not directly provided in the search results, we can infer several structural characteristics based on related mitochondrial proteins and the available information on A. niger MED31 protein.

The recombinant A. niger MED31 protein mentioned in the search results corresponds to amino acids 1-151 with a histidine tag . This information suggests that the full protein consists of at least 151 amino acids. For mitochondrial proteins, several structural features are typically important:

  • Mitochondrial targeting sequences: Most nuclear-encoded mitochondrial proteins contain N-terminal targeting sequences that direct them to mitochondria.

  • Transmembrane domains: Mitochondrial membrane proteins often contain hydrophobic regions that anchor them in mitochondrial membranes.

  • Functional domains: Specialized regions for protein-protein interactions, nucleic acid binding, or enzymatic activity.

  • Post-translational modifications: Sites for phosphorylation, acetylation, or other modifications that regulate protein function.

For mitochondrial DNA-associated proteins like those involved in mtDNA maintenance, specific DNA-binding domains would be expected. This is particularly relevant when considering the specificity demonstrated by engineered proteins like mitoARCUS, which can distinguish between wild-type and mutant mitochondrial DNA with single-nucleotide precision .

The structural characteristics of mitochondrial proteins significantly influence their function, particularly their ability to interact with mitochondrial DNA and other mitochondrial proteins. This becomes evident when examining how precisely engineered nucleases can target specific mitochondrial DNA sequences .

What safety considerations should researchers address when working with A. niger?

Researchers working with Aspergillus niger must address several important safety considerations due to its potential pathogenicity and toxin production. These precautions are essential for protecting laboratory personnel and preventing environmental contamination.

Biological Hazard Assessment:
Aspergillus niger produces spores that can be inhaled when working with colonized materials . While A. niger is generally less dangerous than other Aspergillus species like A. fumigatus (the most prevalent airborne fungal pathogen), it still contains toxins that can cause illness, particularly in immunocompromised individuals . The main toxins include malformin C and ochratoxin A.

Biosafety Procedures:

  • Use of biosafety cabinets for all procedures involving open cultures

  • Personal protective equipment including gloves, lab coats, and respiratory protection when appropriate

  • Proper containment and disposal of cultures and contaminated materials

  • Regular sanitization of work surfaces with appropriate fungicides

Vulnerable Populations:
Special precautions should be taken by researchers who:

  • Have immune deficiencies (leukemia, HIV/AIDS)

  • Suffer from severe fungal allergies

  • Have compromised respiratory function

  • Are taking immunosuppressive medications

A. niger can cause several conditions including Aspergillosis (affecting over 300,000 people worldwide), Otomycosis (ear infections), and hypersensitivity reactions like asthma and allergic alveolitis . There have been rare but severe cases requiring amputation due to A. niger infection .

Laboratory Containment Levels:
A. niger research typically requires at minimum Biosafety Level 1 (BSL-1) facilities, with consideration for BSL-2 when:

  • Working with large volumes of spores

  • Conducting aerosol-generating procedures

  • Working with clinical isolates

  • Handling concentrated toxins

Proper risk assessment and adherence to institutional biosafety guidelines are essential for safe research with A. niger.

How does altered inheritance of mitochondria affect cellular function in A. niger models?

The altered inheritance of mitochondria in A. niger models represents a complex interplay between nuclear and mitochondrial genomes, with profound implications for cellular energetics, stress responses, and development. This question targets the sophisticated mechanisms underlying mitochondrial inheritance patterns.

In mitochondrial research, the concept of heteroplasmy—the coexistence of wild-type and mutant mitochondrial DNA within cells—is crucial for understanding altered inheritance patterns. When the balance shifts toward mutant mitochondrial DNA, cellular dysfunction typically follows . While not specific to A. niger, research with mitoARCUS nucleases demonstrates how targeted elimination of mutant mitochondrial DNA allows wild-type mtDNA to repopulate cells, restoring normal mitochondrial function .

In A. niger specifically, as an aerobic organism capable of surviving in diverse environmental conditions , mitochondrial function is particularly critical. Altered mitochondrial inheritance could influence:

  • Respiratory capacity and ATP production

  • Stress tolerance, particularly to oxidative stressors

  • Secondary metabolite production, including important biotechnological products

  • Growth rates and morphological development

  • Virulence factors relevant to pathogenicity

Research methodologies to investigate these effects typically include:

  • Respirometry to measure oxygen consumption rates

  • ATP quantification assays

  • ROS (Reactive Oxygen Species) detection methods

  • Mitochondrial membrane potential assessments

  • Genetic manipulation to induce specific mitochondrial inheritance patterns

The single-component ARCUS protein system, which has demonstrated efficacy in targeting specific mitochondrial DNA mutations , represents a potential methodological approach for studying altered mitochondrial inheritance in A. niger and other fungal models.

What are the molecular mechanisms behind aim31 function in mitochondrial DNA maintenance?

The molecular mechanisms underlying aim31 function in mitochondrial DNA maintenance represent a sophisticated interplay between protein structure, nucleic acid interactions, and mitochondrial dynamics. Understanding these mechanisms requires integrating insights from structural biology, molecular genetics, and biochemistry.

While specific information about aim31 is not directly provided in the search results, we can draw insights from related mitochondrial proteins and DNA maintenance mechanisms. The ARCUS genome editing system provides a relevant example of how proteins can interact with mitochondrial DNA with remarkable specificity .

Key molecular mechanisms likely involved in aim31 function include:

  • Sequence-Specific DNA Recognition: Similar to how mitoARCUS can distinguish between mutant m.3243G and wild-type m.3243A mitochondrial DNA , aim31 likely contains domains that recognize specific mtDNA sequences or structures.

  • Nucleoid Formation and Stabilization: Mitochondrial DNA is organized into nucleoid structures, which require specialized proteins for proper formation and maintenance.

  • Replication Fork Interaction: Proteins involved in mtDNA maintenance often interact with the mitochondrial replication machinery to ensure faithful DNA replication.

  • Heteroplasmy Management: As demonstrated by mitoARCUS research, the balance between wild-type and mutant mtDNA (heteroplasmy) is crucial for mitochondrial function . Aim31 may participate in regulating this balance.

  • Response to Mitochondrial Stress: Proteins like aim31 likely change their interaction patterns with mtDNA under conditions of cellular stress.

Experimental approaches to elucidate these mechanisms might include:

  • Chromatin immunoprecipitation (ChIP) to identify DNA binding sites

  • Structural studies using cryo-EM or X-ray crystallography

  • Genetic knockout/knockdown studies followed by mtDNA stability assessment

  • Protein-protein interaction studies to identify binding partners

  • In vitro reconstitution of DNA binding and processing activities

Understanding these molecular mechanisms could provide insights for targeted interventions in mitochondrial disease states, similar to the approach demonstrated with mitoARCUS .

How do researchers distinguish between direct and indirect effects when studying recombinant aim31 protein?

Distinguishing between direct and indirect effects when studying recombinant aim31 protein represents one of the most challenging aspects of mitochondrial protein research. This distinction requires sophisticated experimental design and careful controls.

Methodological Approaches for Distinguishing Effects:

  • Time-Course Experiments:

    • Rapid effects (seconds to minutes) following aim31 introduction or modification are more likely direct

    • Delayed effects (hours to days) may represent downstream consequences

    • Capturing data at multiple time points allows temporal mapping of effect cascade

  • Dose-Response Relationships:

    • Direct effects typically show clear dose-dependent relationships

    • Indirect effects may exhibit threshold phenomena or non-linear responses

    • Example data structure:

    Protein Concentration (μg/ml)Direct Parameter (mtDNA binding %)Indirect Parameter (ATP production %)
    0 (control)0100
    0.11598
    1.04595
    10.07875
    100.09240
  • In Vitro Reconstitution:

    • Purified components in minimal systems can establish direct biochemical activities

    • Comparison with cellular outcomes identifies potential indirect effects

    • Similar to how mitoARCUS was validated for direct targeting of mutant mtDNA

  • Protein Engineering Approaches:

    • Structure-function studies with mutated versions of aim31

    • Activity-dead mutants that maintain protein-protein interactions

    • Domain swapping experiments

  • Omics Integration:

    • Transcriptomics, proteomics, and metabolomics at various time points

    • Network analysis to map propagation of effects

    • Identification of hub points vs. peripheral effects

  • Genetic Background Variation:

    • Testing effects in different strain backgrounds

    • Dependency on other genes indicates potential indirect mechanisms

    • Independent replication across genetic contexts strengthens direct effect evidence

This multi-layered approach mirrors sophisticated strategies used in mitochondrial research, such as those demonstrated in the mitoARCUS study, where specific targeting of mutant mtDNA was validated through multiple experimental paradigms .

What evolutionary insights can be gained from studying A. niger aim31 compared to other fungal species?

Evolutionary analysis of Aspergillus niger aim31 compared to other fungal species provides valuable insights into mitochondrial function conservation and adaptation across diverse ecological niches. This comparative approach reveals evolutionary pressures shaping mitochondrial inheritance mechanisms.

Evolutionary Conservation Patterns:

The genus Aspergillus contains hundreds of mold species distributed worldwide, with A. niger representing one extensively studied member . These species occupy diverse ecological niches, from nutrient-rich environments to nutrient-poor conditions . This ecological diversity provides an excellent framework for evolutionary comparisons.

Several evolutionary insights can be gained through comparative studies:

  • Functional Domain Conservation:

    • Core functional domains of aim31 likely show high conservation across fungal lineages

    • Substrate-binding regions may demonstrate lineage-specific adaptations

    • Regulatory domains often show more rapid evolutionary divergence

  • Adaptation to Metabolic Requirements:
    A. niger's remarkable ability to grow under various conditions, including high osmotic pressure environments , suggests specialized mitochondrial adaptations. Comparing aim31 across species with different metabolic capabilities could reveal:

    • Adaptations for aerobic metabolism efficiency

    • Modifications supporting osmotic stress tolerance

    • Changes enhancing survival in carbohydrate-rich environments

  • Pathogenicity Correlation:
    With over 60 Aspergillus species identified as pathogens , comparative analysis can reveal whether aim31 variants correlate with pathogenic potential. This becomes especially relevant considering A. niger's ability to cause human and animal infections .

  • Horizontal Gene Transfer Assessment:

    • Evidence of horizontal gene transfer events shaping aim31 evolution

    • Acquisition of novel functional domains across fungal lineages

    • Convergent evolution in response to similar selective pressures

  • Mitochondrial-Nuclear Genome Co-evolution:
    Similar to how mitoARCUS targets specific mitochondrial DNA sequences , natural mitochondrial proteins must maintain specific interactions with the mitochondrial genome. Comparing these interaction patterns across species reveals co-evolutionary constraints.

Methodologically, these evolutionary insights require:

  • Comprehensive phylogenetic analysis

  • Selection pressure calculation (dN/dS ratios)

  • Structural modeling of aim31 across species

  • Functional complementation experiments across species boundaries

  • Correlation of molecular changes with ecological adaptations

How do post-translational modifications affect aim31 function in mitochondrial dynamics?

Post-translational modifications (PTMs) of aim31 represent a sophisticated regulatory layer controlling mitochondrial dynamics and function. These chemical changes to the protein after translation allow for rapid, reversible adjustments to mitochondrial activity in response to changing cellular conditions.

While specific information about aim31 PTMs is not provided in the search results, we can draw from established principles in mitochondrial protein regulation to outline key aspects of this regulatory system:

Key PTMs Affecting Mitochondrial Proteins:

  • Phosphorylation:

    • Most common regulatory PTM

    • Alters protein charge, conformation, and activity

    • Often responds to energy status changes

    • Typically mediated by kinases responding to cellular signaling cascades

  • Acetylation:

    • Particularly relevant in mitochondrial proteins

    • Responds to metabolic flux and acetyl-CoA availability

    • Regulates protein stability and interactions

  • Ubiquitination/SUMOylation:

    • Controls protein turnover and quality control

    • Regulates protein-protein interactions

    • Involved in stress responses

  • Proteolytic Processing:

    • Mitochondrial targeting sequences are often cleaved upon import

    • Activation of some proteins requires proteolytic maturation

The functional consequences of these modifications likely include:

  • Altered binding affinity for mitochondrial DNA

  • Changed interaction patterns with other mitochondrial proteins

  • Modified subcellular localization

  • Adjustments in enzymatic activity

  • Altered protein stability and turnover rates

Methodologically, studying these PTMs requires sophisticated approaches:

PTM TypeDetection MethodFunctional Validation ApproachData FormatAnalysis Challenge
PhosphorylationLC-MS/MS with phospho-enrichmentPhosphomimetic mutations.raw, .mgfSite localization
AcetylationAcetyl-lysine antibodies, MSDeacetylase inhibitors.tiff, .rawStoichiometry determination
UbiquitinationUbiquitin remnant antibodiesProteasome inhibitors.xlsx, .rawDistinguishing regulatory vs. degradative
Proteolytic processingN-terminal sequencingImport assays with mutants.ab1, .fastaIdentifying responsible proteases

The complexity of PTM patterns in mitochondrial proteins mirrors the sophisticated regulation observed in other systems, such as the precise targeting demonstrated by engineered proteins like mitoARCUS , where protein function is highly dependent on structural and chemical properties.

What are the most effective expression systems for producing functional recombinant aim31?

Selecting the optimal expression system for producing functional recombinant aim31 requires careful consideration of protein characteristics, experimental objectives, and downstream applications. Different expression systems offer distinct advantages and limitations that significantly impact protein yield, folding, and post-translational modifications.

Comparative Analysis of Expression Systems for aim31:

  • Prokaryotic Expression Systems (E. coli):

    • Advantages: Rapid growth, high yield, simple genetic manipulation, cost-effective

    • Limitations: Lack of eukaryotic post-translational modifications, potential inclusion body formation

    • Optimization strategies: Codon optimization, fusion tags (His-tag as used with A. niger MED31 ), solubility enhancers, specialized strains (Rosetta, Origami)

    • Yield expectation: 10-100 mg/L culture

  • Yeast Expression Systems (P. pastoris, S. cerevisiae):

    • Advantages: Eukaryotic protein processing, higher likelihood of correct folding, scalable

    • Limitations: Longer cultivation time, potential hyperglycosylation

    • Optimization strategies: Inducible promoters, secretion signals, growth optimization

    • Yield expectation: 5-50 mg/L culture

  • Insect Cell Expression (Baculovirus):

    • Advantages: Complex protein folding, more "native-like" PTMs, suitable for multi-domain proteins

    • Limitations: Technical complexity, higher cost, longer timeframe

    • Optimization strategies: Optimized viral vectors, cell line selection, infection parameters

    • Yield expectation: 1-20 mg/L culture

  • Mammalian Cell Expression:

    • Advantages: Most authentic post-translational modifications, ideal for functional studies

    • Limitations: Highest cost, lowest yield, technical complexity

    • Optimization strategies: Stable cell line generation, transient transfection optimization

    • Yield expectation: 0.1-10 mg/L culture

  • Native A. niger Expression:

    • Advantages: Native environment for A. niger proteins, authentic modifications

    • Limitations: Less established than other systems, potential endogenous protease issues

    • Optimization strategies: Promoter selection, protease-deficient strains

    • Yield expectation: 1-50 mg/L culture

Decision-Making Framework:

Primary Research ObjectiveRecommended Expression SystemKey Optimization ParameterQuality Control Approach
Structural studiesE. coli or P. pastorisSoluble protein yieldSEC-MALS, CD spectroscopy
Functional assaysYeast or insect cellsActivity preservationActivity assays, binding studies
Interaction studiesMammalian or native A. nigerAuthentic PTMsCo-IP, BLI, SPR
Large-scale applicationsE. coli or P. pastorisCost-effective scalingProcess optimization, FPLC

This methodological approach aligns with established recombinant protein production strategies while considering the specific challenges of mitochondrial proteins, which often require proper folding and modification for functional activity, similar to the precision required for engineered proteins like mitoARCUS .

What purification strategies yield the highest activity retention for recombinant aim31?

Purification of recombinant aim31 with maximal activity retention requires carefully designed protocols that preserve protein structure and function while achieving high purity. The ultimate purification strategy must balance yield, purity, activity, and scalability based on experimental requirements.

Core Purification Strategies and Their Impact on aim31 Activity:

  • Affinity Chromatography Approaches:

    • His-tag purification: The use of histidine tags, as seen with recombinant A. niger MED31 protein , provides selective capture on Ni-NTA or IMAC resins

    • Activity impact: Minimal disruption if tag position is optimized; consider TEV protease cleavage

    • Buffer considerations: Imidazole concentration gradient optimization to minimize non-specific binding while maximizing yield

  • Size Exclusion Chromatography (SEC):

    • Separation principle: Molecules separated based on hydrodynamic radius

    • Activity impact: Minimal since conducted under native conditions

    • Buffer optimization: Buffer exchange capability allows transition to optimal storage conditions

    • Resolution challenge: Limited capacity, dilution effect

  • Ion Exchange Chromatography:

    • Separation principle: Based on protein surface charge differences

    • Activity impact: pH and salt conditions must be optimized to maintain structure

    • Strategy optimization: Step vs. gradient elution based on stability profile

  • Hydrophobic Interaction Chromatography:

    • Separation principle: Based on surface hydrophobicity differences

    • Activity impact: High salt concentrations may affect folding; requires careful optimization

    • Application: Particularly useful for separating protein variants with subtle differences

Multi-step Purification Strategy for Maximum Activity Retention:

Purification StepTechniqueBuffer CompositionCritical ParametersActivity Monitoring Method
CaptureIMAC (His-tag)50 mM Tris pH 8.0, 300 mM NaCl, 10-250 mM imidazoleFlow rate, imidazole gradientQualitative binding assay
IntermediateIon exchange20 mM HEPES pH 7.5, 50-500 mM NaClpH, salt gradientDNA-binding assay
PolishingSize exclusion25 mM HEPES pH 7.4, 150 mM NaCl, 10% glycerol, 1 mM DTTFlow rate, sample volumeFull activity assay

Stability Enhancement During Purification:

  • Addition of glycerol (5-10%) to prevent aggregation

  • Inclusion of reducing agents (DTT, TCEP) to maintain reduced state

  • Protease inhibitor cocktails to prevent degradation

  • Temperature control (typically 4°C) throughout procedure

  • Consider adding specific cofactors or binding partners

Analytical Quality Control:

  • SDS-PAGE for purity assessment

  • Western blotting for identity confirmation

  • Mass spectrometry for intact mass verification

  • Dynamic light scattering for aggregation assessment

  • Circular dichroism for secondary structure evaluation

This comprehensive purification strategy draws on established protein purification principles while addressing the specific challenges of maintaining activity for mitochondrial proteins, which often have specific folding requirements and cofactor dependencies for optimal function.

How can researchers effectively measure aim31 interaction with mitochondrial DNA?

Measuring aim31 interactions with mitochondrial DNA requires sophisticated methodologies that can detect, quantify, and characterize these molecular interactions with high sensitivity and specificity. Multiple complementary approaches provide a comprehensive understanding of the binding dynamics and functional consequences.

In Vitro Interaction Analysis Methods:

  • Electrophoretic Mobility Shift Assay (EMSA):

    • Principle: Detection of DNA-protein complexes through migration shifts in non-denaturing gels

    • Quantification: Densitometry of shifted vs. unshifted bands

    • Advantages: Relatively simple, can detect multiple binding states

    • Limitations: Semi-quantitative, limited to stable interactions

  • Surface Plasmon Resonance (SPR):

    • Principle: Real-time detection of biomolecular interactions through refractive index changes

    • Quantification: Association/dissociation rate constants, equilibrium binding constants

    • Advantages: Label-free, kinetic information, high sensitivity

    • Limitations: Requires specialized equipment, potential surface effects

  • Microscale Thermophoresis (MST):

    • Principle: Detection of changes in thermophoretic movement upon binding

    • Quantification: Binding affinity (Kd) determination

    • Advantages: Low sample consumption, solution-phase measurements

    • Limitations: Requires fluorescent labeling, potential label interference

Cellular and Organellar Approaches:

  • Chromatin Immunoprecipitation (ChIP):

    • Principle: Antibody-mediated pulldown of protein-DNA complexes followed by DNA analysis

    • Quantification: qPCR or sequencing of precipitated DNA

    • Advantages: Identification of binding sites in native context

    • Limitations: Requires specific antibodies, potential crosslinking artifacts

  • Proximity Ligation Assay (PLA):

    • Principle: Detection of closely positioned molecules through antibody-mediated DNA ligation

    • Quantification: Fluorescent signal quantification

    • Advantages: Single-molecule sensitivity, spatial information

    • Limitations: Technical complexity, requires specific antibodies

Integrative Data Analysis Framework:

MethodData TypeQuantitative ParametersComplementary MethodsExample Application
EMSAGel imagesKd (apparent), Hill coefficientFootprinting for sequence specificityInitial binding characterization
SPRSensorgramskon, koff, KdITC for thermodynamic parametersDetailed kinetic analysis
ChIP-seqSequencing dataBinding site distribution, motif enrichmentRNA-seq for functional correlationGenome-wide binding pattern
CRISPR screeningViability/function scoresGenetic dependency scoresProteomics for complex formationFunctional significance validation

This methodological framework mirrors the sophisticated approaches used in mitochondrial DNA research, such as those employed to validate the specificity of mitoARCUS nuclease, which was shown to precisely discriminate between wild-type and mutant mitochondrial DNA with single-nucleotide precision .

What controls are essential when studying recombinant A. niger proteins in heterologous systems?

Implementing appropriate controls is critical when studying recombinant A. niger proteins in heterologous systems to ensure experimental validity and reliable data interpretation. A comprehensive control strategy accounts for expression system variables, protein-specific factors, and experimental design considerations.

Essential Control Categories:

  • Expression System Controls:

    a) Empty Vector Control:

    • Cells transformed with expression vector lacking the target gene

    • Controls for vector-induced changes in host physiology

    • Essential for distinguishing background effects from protein-specific outcomes

    b) Host Strain Background Control:

    • Untransformed host cells

    • Baseline for comparing physiological changes

    • Accounts for medium/growth condition effects

    c) Known Protein Expression Control:

    • Well-characterized protein expressed under identical conditions

    • Validates expression system functionality

    • Provides reference for expression levels and behavior

  • Protein-Specific Controls:

    a) Inactive Variant:

    • Catalytically inactive mutant (if aim31 has enzymatic activity)

    • Created through site-directed mutagenesis of critical residues

    • Distinguishes between binding-dependent and activity-dependent effects

    b) Tagged vs. Untagged Versions:

    • Controls for potential tag interference with function

    • Especially important when using His-tags as with A. niger MED31 protein

    • May include tag-only controls for antibody specificity validation

    c) Orthologous Protein Control:

    • Related protein from different species

    • Assesses conservation of function

    • Identifies species-specific interactions

  • Mitochondrial-Specific Controls:

    a) Mitochondrial Localization Controls:

    • Non-mitochondrial protein with added mitochondrial targeting sequence

    • Controls for effects of mitochondrial import

    • Distinguishes import defects from functional defects

    b) Mitochondrial DNA Depletion:

    • Cells with reduced or eliminated mitochondrial DNA

    • Tests dependency of phenotypes on mtDNA interaction

    • Similar to approaches used in mitoARCUS studies on mtDNA targeting

    c) Mitochondrial Stress Response Controls:

    • Treatment with known mitochondrial stressors

    • Distinguishes specific protein effects from general stress responses

    • Includes ROS generators, membrane potential disruptors

Control Implementation Framework:

Experimental AspectPrimary ControlSecondary ControlData Representation
Expression validationWestern blot with anti-tag antibodyMass spectrometry confirmationQuantitative comparison to reference
LocalizationMitochondrial marker co-localizationSubcellular fractionationPearson correlation coefficient
DNA binding specificityScrambled DNA sequenceCompetitor assayRelative affinity ratios
Functional impactInactive mutant comparisonChemical inhibitionNormalized activity measurements
System-wide effectsEmpty vector baselineTime-course analysisFold change with statistical significance

This control framework ensures robust data interpretation while accounting for the complexities of heterologous expression and mitochondrial targeting, critical factors when studying specialized proteins like those involved in mitochondrial DNA maintenance and function .

What are the challenges in scaling up aim31 production for extensive functional studies?

Scaling up aim31 production for extensive functional studies presents multifaceted challenges spanning bioprocess engineering, protein quality control, and economic considerations. Successful scale-up requires systematic approaches to maintain protein quality while increasing quantity.

Key Scale-up Challenges and Mitigation Strategies:

  • Expression System Scalability:

    a) Challenge: Expression levels often decrease in larger culture volumes

    • Mitigation: Optimize oxygen transfer through improved bioreactor design

    • Monitoring parameter: Dissolved oxygen tension (DOT) maintenance above 30%

    • Implementation: Staged impeller systems, supplemental oxygen sparging

    b) Challenge: Increased metabolic burden in high-density cultures

    • Mitigation: Fed-batch cultivation with optimized feeding strategy

    • Monitoring parameter: Growth rate, nutrient consumption rates

    • Implementation: Exponential feeding algorithms based on oxygen uptake rate

  • Protein Quality Consistency:

    a) Challenge: Increased misfolding and inclusion body formation at higher expression rates

    • Mitigation: Reduced induction temperature, co-expression of chaperones

    • Monitoring parameter: Soluble vs. insoluble protein ratio

    • Implementation: Temperature shift protocols, strain engineering

    b) Challenge: Post-translational modification heterogeneity

    • Mitigation: Process optimization for consistent modification patterns

    • Monitoring parameter: Mass spectrometry modification profiling

    • Implementation: Controlled growth parameters, media optimization

  • Purification Scale-up Complexities:

    a) Challenge: Column chromatography scale limitations

    • Mitigation: Transition to continuous chromatography systems

    • Monitoring parameter: Dynamic binding capacity, pressure tolerance

    • Implementation: Periodic counter-current chromatography, membrane adsorbers

    b) Challenge: Buffer consumption and waste generation

    • Mitigation: Buffer recycling, concentrated stock solutions

    • Monitoring parameter: Resource utilization metrics

    • Implementation: Inline buffer dilution systems, single-use technology

  • Functional Activity Preservation:

    a) Challenge: Activity loss during extended processing time

    • Mitigation: Process intensification, minimized hold times

    • Monitoring parameter: Time-dependent activity assays

    • Implementation: Continuous processing where feasible

    b) Challenge: Oxidative damage during processing

    • Mitigation: Oxygen-free environments, antioxidant addition

    • Monitoring parameter: Oxidation-sensitive residue monitoring

    • Implementation: Nitrogen blanketing, reducing agent optimization

Scale-up Decision Framework:

ScaleCulture VolumeExpression SystemKey ChallengesCritical Control Points
Laboratory1-10 LShake flasks/small bioreactorsProtocol optimizationExpression level, solubility
Pilot10-100 LInstrumented bioreactorsProcess parameter translationScale-dependent parameters, homogeneity
Production100-1000+ LIndustrial bioreactorsEconomic viability, GMP considerationsConsistency, contamination control

This comprehensive scale-up framework addresses the specific challenges of mitochondrial protein production, where functional activity is particularly sensitive to production conditions. The approach is comparable to the careful optimization required for production of sophisticated engineered proteins like mitoARCUS , where functional integrity is paramount for specific mitochondrial DNA targeting.

How should researchers interpret contradictory results between in vitro and in vivo experiments with aim31?

Contradictions between in vitro and in vivo experiments with aim31 represent a common challenge in mitochondrial protein research. These discrepancies often provide valuable insights into the complex regulatory networks and contextual factors influencing protein function. A systematic interpretative framework helps navigate these contradictions productively.

Systematic Approach to Resolving Contradictions:

  • Contextual Factor Analysis:

    a) Cellular Environment Complexity:

    • In vitro systems lack the full complement of mitochondrial proteins

    • Mitochondrial membrane potential and pH gradients are difficult to replicate

    • Metabolic state influences are absent in simplified systems

    b) Interactome Differences:

    • In vivo binding partners may alter aim31 function

    • Competitive binding effects from other mitochondrial proteins

    • Post-translational modification differences between systems

  • Methodological Reconciliation Framework:

    Contradiction TypeIn Vitro ObservationIn Vivo ObservationReconciliation ApproachValidation Method
    Activity levelHigh specific activityLimited functional impactIdentify regulatory inhibitorsIsolation of native complexes
    Binding specificityPromiscuous DNA bindingSite-specific genome associationMap cellular factors enhancing specificityChIP-seq with competition assays
    Subcellular locationExclusively mitochondrialAdditional cytosolic fractionCharacterize conditional import mechanismsFractionation with dynamic stimuli
    Protein stabilityHighly stableRapid turnoverIdentify degradation pathwaysPulse-chase with inhibitors
  • Biological Significance Assessment:

    a) Physiological Relevance Filter:

    • Which system better reflects physiological conditions?

    • Are contradictions related to adaptive regulatory mechanisms?

    • Could artificial constraints in either system explain differences?

    b) Evolutionary Conservation Context:

    • Are contradictory aspects conserved across species?

    • Do related proteins show similar discrepancies?

    • Similar to the high conservation expected in mitochondrial targeting mechanisms, as seen in ARCUS systems

  • Resolution Strategies:

    a) Bridging Experiments:

    • Gradually increase system complexity to identify inflection points

    • Reconstitution experiments with defined components

    • Hybrid systems combining in vitro and cellular components

    b) Mathematical Modeling:

    • Develop models incorporating both datasets

    • Identify missing parameters that could explain discrepancies

    • Predict conditions where contradictions would be resolved

    c) Alternative Hypothesis Generation:

    • Formulate new models accommodating both observations

    • Consider dual functionality under different conditions

    • Explore context-dependent switching mechanisms

This approach aligns with sophisticated interpretative frameworks used in mitochondrial research, such as those addressing the complexity of mitochondrial DNA heteroplasmy in the context of engineered nucleases like mitoARCUS , where understanding context-dependent effects is crucial for translating findings between experimental systems.

What statistical methods are most appropriate for analyzing aim31 interaction data?

Data-Specific Statistical Approaches:

  • Binding Affinity Experiments:

    a) Equilibrium Binding Data:

    • Primary method: Nonlinear regression for Kd determination

    • Model selection: One-site vs. multi-site binding models using AIC/BIC criteria

    • Robustness check: Bootstrap resampling for confidence interval estimation

    • Sample calculation: For data following the equation:

      Y=Bmax×XKd+XY = \frac{B_{max} \times X}{K_d + X}

      Where Y is the measured binding, X is the concentration, Bmax is maximum binding, and Kd is the dissociation constant.

    b) Kinetic Binding Data:

    • Primary method: Global fitting of association/dissociation phases

    • Validation: Residual analysis for systematic deviations

    • Advanced approach: Kinetic competition analysis for complex mechanisms

  • Comparative Biochemical Assays:

    a) Activity Comparisons:

    • Primary test: ANOVA with post-hoc tests (Tukey's, Bonferroni)

    • Non-parametric alternative: Kruskal-Wallis with Dunn's post-hoc

    • Dose-response analysis: EC50/IC50 calculation with comparison using extra sum-of-squares F test

    b) Interaction Modification Experiments:

    • Synergy analysis: Combination index calculation

    • Interaction modeling: Factorial design analysis

  • High-Throughput Screening Data:

    a) NGS-Based Binding Site Identification:

    • Enrichment analysis: DESeq2 or edgeR for differential binding

    • Peak calling: MACS2 with appropriate controls

    • Motif discovery: MEME suite with statistical significance assessment

    b) Protein-Protein Interaction Screens:

    • Network analysis: Significance of interaction using permutation tests

    • Clustering: Hierarchical clustering with approximately unbiased p-values

Statistical Analysis Decision Framework:

Data TypeSample Size ConsiderationsAppropriate TestsMultiple Testing CorrectionEffect Size Representation
Binding constants (Kd)Minimum 6-8 concentrations spanning 0.1-10× KdF-test for model comparisonNot typically required for model fitting95% confidence intervals
Activity measurementsPower analysis (80% power, α=0.05)t-tests or ANOVABenjamini-Hochberg FDRCohen's d or fold change
Genome-wide bindingDepends on genome size and binding frequencyHypergeometric test for enrichmentBenjamini-Hochberg FDRFold enrichment, q-values
Structural measurementsMinimum 3 technical, 3 biological replicatesAppropriate for measurement typeConsider family-wise error rateStandard deviation or SEM

Advanced Statistical Considerations:

  • Bayesian Approaches:

    • Prior incorporation when previous data exists

    • Markov Chain Monte Carlo for complex models

    • Posterior probability distributions instead of p-values

  • Machine Learning Integration:

    • Random forest for feature importance in complex datasets

    • Support vector machines for classification of interaction types

    • Deep learning for pattern recognition in large datasets

This statistical framework aligns with the sophisticated analytical approaches required for mitochondrial research, similar to those used to validate the precision of engineered nucleases like mitoARCUS, where statistical rigor is essential for confirming specific interactions with mitochondrial DNA targets .

How can researchers integrate aim31 functional data with broader mitochondrial proteomics data?

Integrating aim31 functional data with broader mitochondrial proteomics represents a sophisticated challenge requiring multi-dimensional data integration strategies. This integration provides context for understanding aim31's role within the complex mitochondrial interactome and regulatory networks.

Multi-Omics Integration Strategies:

  • Network-Based Integration Approaches:

    a) Protein-Protein Interaction Networks:

    • Construction of mitochondrial interactome maps

    • Placement of aim31 within interaction hubs

    • Identification of first, second, and third-shell interactors

    • Edge weighting based on interaction confidence

    b) Functional Correlation Networks:

    • Co-expression analysis across tissues/conditions

    • Functional enrichment of connected nodes

    • Pathway impact analysis

    • Identification of synchronously regulated modules

  • Data Visualization and Exploration Frameworks:

    a) Multi-dimensional Data Visualization:

    • Principal Component Analysis for dimension reduction

    • t-SNE or UMAP for non-linear relationships

    • Clustered heatmaps for condition-dependent changes

    • Circular plots for genomic-proteomic integration

    b) Interactive Exploration Tools:

    • Cytoscape for network visualization and analysis

    • R Shiny applications for dynamic data exploration

    • Custom dashboards integrating multiple data types

  • Quantitative Integration Methodologies:

    a) Statistical Integration:

    • Canonical correlation analysis between datasets

    • Partial least squares regression for relationship modeling

    • Bayesian network construction for causal inference

    • MOFA (Multi-Omics Factor Analysis) for latent factor discovery

    b) Machine Learning Approaches:

    • Random forest for feature importance ranking

    • Support vector machines for phenotype classification

    • Deep learning for complex pattern recognition

    • Self-organizing maps for unsupervised clustering

Practical Integration Framework:

Integration LevelRequired Data TypesIntegration MethodsOutput FormatBiological Insight Type
Physical interactionsAP-MS, BioID, Y2H, FRETDirect network constructionInteraction networkProtein complexes, functional modules
Functional relationshipsRNA-seq, proteomics, metabolomicsCorrelation analysis, regressionFunction-based networkCo-regulated processes, compensatory mechanisms
Regulatory connectionsChIP-seq, ATAC-seq, proteomicsCausal modeling, time-series analysisDirected regulatory networkUpstream regulators, feedback loops
Structural contextCryo-EM, X-ray crystallography, AlphaFold3D structure mappingAnnotated structural modelsInteraction interfaces, conformational changes

Case Study Application:

This integration approach can be illustrated through a case study similar to the mitoARCUS system , where understanding a protein's function requires placing it within the broader context of mitochondrial biology:

  • Functional characterization of aim31's direct effects on mtDNA (similar to mitoARCUS targeting specific mtDNA sequences )

  • Proteomics identification of proteins affected by aim31 presence/absence

  • Pathway analysis to place these proteins in biological context

  • Network construction connecting aim31 to mitochondrial systems

  • Phenotypic correlation linking molecular changes to functional outcomes

This integrated analysis framework provides a comprehensive understanding of aim31's role within the mitochondrial system, similar to how mitoARCUS was characterized not only for its direct DNA targeting but also for its broader impact on mitochondrial function and heteroplasmy .

What are the key indicators of successful genetic incorporation of recombinant aim31 in model organisms?

Successful genetic incorporation of recombinant aim31 in model organisms requires comprehensive validation across multiple levels of biological organization. Key indicators span molecular verification, subcellular localization, functional impact, and system-wide effects.

Multi-level Validation Framework:

  • Genomic Integration Confirmation:

    a) DNA-level Verification:

    • PCR verification with junction-spanning primers

    • Southern blot for copy number determination

    • Whole genome sequencing for precise integration mapping

    • Off-target analysis using bioinformatic prediction followed by targeted sequencing

    b) Integration Stability Assessment:

    • Multi-generational PCR tracking

    • Long-term culture stability testing

    • Stress-induced stability evaluation

    • Methylation status at integration sites

  • Expression Verification:

    a) Transcriptional Validation:

    • RT-qPCR for mRNA quantification

    • RNA-seq for transcript isoform analysis

    • 5' and 3' RACE for transcript termini characterization

    • Nuclear run-on assays for transcription rate determination

    b) Protein Production Confirmation:

    • Western blotting with specific antibodies

    • Mass spectrometry for protein identification

    • Pulse-chase analysis for protein stability

    • Quantitative proteomics for expression level comparison

  • Subcellular Localization:

    a) Microscopy-Based Approaches:

    • Immunofluorescence with mitochondrial co-markers

    • Live-cell imaging with fluorescent fusion proteins

    • Super-resolution microscopy for detailed localization

    • Electron microscopy for ultrastructural localization

    b) Biochemical Fractionation:

    • Differential centrifugation for mitochondrial isolation

    • Protease protection assays for submitochondrial localization

    • Membrane association tests

    • Import assays with isolated mitochondria

  • Functional Validation:

    a) Molecular Function Assessment:

    • DNA binding assays (similar to mitoARCUS validation )

    • Protein interaction studies (co-IP, BioID)

    • Enzymatic activity measurements if applicable

    • Heteroplasmy shift analysis for mtDNA-targeting proteins

    b) Organelle-level Impact:

    • Mitochondrial membrane potential measurements

    • Respiration analysis (oxygen consumption rate)

    • mtDNA copy number quantification

    • Mitochondrial morphology assessment

Comprehensive Validation Data Table:

Validation LevelPrimary AssaySecondary AssayExpected ResultPotential CaveatsResolution Approach
GenomicJunction PCRSouthern blotSpecific bands of predicted sizeConcatemeric insertionsLong-read sequencing
TranscriptionalRT-qPCRRNA-seqExpression at designed levelsSilencing over timeEpigenetic modifiers
ProteinWestern blotMass spectrometrySingle band of correct sizePost-translational processingN- and C-terminal tagging
LocalizationImmunofluorescenceSubcellular fractionationMitochondrial co-localizationMislocalization due to overexpressionTitrated expression systems
FunctionDNA bindingHeteroplasmy analysisSpecific mtDNA interactionCompensatory mechanismsAcute induction systems
PhenotypicRespirationStress resistanceRestored/enhanced functionDevelopmental adaptationInducible expression

This comprehensive validation framework ensures that genetic incorporation has occurred correctly and is producing functional protein in the appropriate cellular compartment, similar to the validation approach that would be necessary for sophisticated mitochondrial targeting proteins like mitoARCUS .

What bioinformatic approaches best predict aim31 function across fungal species?

Bioinformatic prediction of aim31 function across fungal species requires sophisticated computational approaches that integrate sequence analysis, structural prediction, evolutionary patterns, and functional genomics data. These approaches provide powerful insights into conserved and divergent aspects of aim31 function across the fungal kingdom.

Multi-layered Bioinformatic Analysis Framework:

  • Sequence-Based Function Prediction:

    a) Homology Detection and Alignment:

    • PSI-BLAST for distant homolog identification

    • HMMER for profile-based searches

    • MUSCLE/MAFFT for multiple sequence alignment

    • CLANS for clustering of sequence relationships

    b) Domain and Motif Analysis:

    • InterProScan for functional domain identification

    • MEME/GLAM2 for de novo motif discovery

    • ScanProsite for functional motif detection

    • DisProt for disordered region prediction

  • Structural Bioinformatics Approaches:

    a) Structure Prediction:

    • AlphaFold2/RoseTTAFold for 3D structure prediction

    • I-TASSER for template-based modeling

    • SWISS-MODEL for homology modeling

    • FoldX for stability and mutation effect prediction

    b) Structure-Function Analysis:

    • CASTp for binding pocket identification

    • ProFunc for function from structure prediction

    • COACH for ligand binding site prediction

    • ElectroSurfProp for electrostatic surface analysis

  • Evolutionary Analysis Methods:

    a) Phylogenetic Analysis:

    • Maximum likelihood trees with RAxML/IQ-TREE

    • Bayesian inference with MrBayes

    • Reconciliation with species trees using NOTUNG

    • Selection analysis with PAML/HyPhy

    b) Coevolutionary Analysis:

    • Mutual information analysis for coevolving residues

    • Direct coupling analysis for structural contacts

    • Comparative genomic context analysis

    • Phylogenetic profiling across fungal species

  • Systems Biology Integration:

    a) Functional Genomics Integration:

    • Gene neighborhood conservation analysis

    • Expression correlation across conditions

    • Phenotype association through GWAS

    • Protein-protein interaction prediction

    b) Network-Based Approaches:

    • Interologous interaction transfer

    • Network alignment across species

    • Pathway enrichment analysis

    • Random walk with restart for functional prediction

Analytical Pipeline for Cross-Species Function Prediction:

Analysis StageKey MethodsInformatic ToolsOutput FormatValidation Approach
Sequence collectionDatabase mining, HMM searchesHMMER, BLASTMulti-FASTAManual curation, coverage assessment
Evolutionary analysisPhylogenetics, selection analysisIQ-TREE, PAMLPhylogenetic trees, dN/dS ratiosBootstrap support, likelihood tests
Structural modeling3D structure predictionAlphaFold2, I-TASSERPDB format modelsQMEANDisCo scores, RMSD to known structures
Function predictionDomain analysis, binding site predictionInterProScan, CASTpAnnotated features, GO termsCross-validation, literature consistency
Experimental designBased on predictionsCustom scriptsTestable hypothesesExperimental validation plan

Application to Fungal Comparative Genomics:

This approach is particularly powerful for studying proteins across the diverse Aspergillus genus, which contains hundreds of mold species distributed worldwide in various climates . The genus includes both pathogenic species causing human and animal infections and beneficial species used in fermentation , providing an excellent comparative context for functional prediction.

Similar bioinformatic approaches have been essential for the development of targeted nucleases like mitoARCUS , which require sophisticated computational design to achieve single-nucleotide specificity. The precision demonstrated by mitoARCUS in distinguishing between wild-type and mutant mitochondrial DNA exemplifies how advanced bioinformatic prediction can translate into functional specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.