Recombinant Aspergillus niger Formation of crista junctions protein 1 (fcj1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
mic60; An04g02460; MICOS complex subunit mic60; Mitofilin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
48-631
Protein Length
Full Length of Mature Protein
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Target Names
mic60
Target Protein Sequence
ADIKPPTTAAPTPATPSSESAVPPETVPKPSPAGQESTLPPSTPPTPAPKGGRFRRFLLY LLLTSGFAYGGGVFLALKFDNFHDFFTEYIPYGEESVLYFEERDFYRRFPNTLRNQNRLN PTPRDEGNKITIPSKSGLTSKVAEEEISGADVSQKGPHMSATPAQKSSEAQTKPAAAKPE DKTTAVVKAKEDKAAKEAEKKEEPRQPAIPAVTPLEFAQVNEGDEAIVQELVKTFNDMIT VISADENSGKYSQPVAKAKEELQKVGEKIIAVREEARRAAQEEIQQAHATFDESARELIR RFDEMRAADAAQYREEFEAEREKLAHAYQEKIRTELQRAQEVAEQRLKNELVEQAIELNR KYLHEVKELVEREREGRLSKLNELTANVSELEKLTSGWREVIDSNLRTQQLQVAVDAVRS VVDRSAVPRPFVRELVAVKELAAEDPVVEAAISSINPAAYQRGIPSTSQIIERFRRVADE VRKASLLPEDAGIASHAASVVLSKVMFKKDAVAGSDDVESVLYRTESLLEEGNLDAAARE MNSLSGWAKILSKDWLVDVRRVLEVKQALEVIETEARLQCLRVE
Uniprot No.

Target Background

Function
Recombinant Aspergillus niger Formation of crista junctions protein 1 (fcj1) is a component of the mitochondrial contact site and cristae organizing system (MICOS) complex. This large protein complex, located in the inner mitochondrial membrane, plays vital roles in maintaining crista junctions, preserving inner membrane architecture, and forming contact sites with the outer membrane. fcj1 contributes to the structural integrity of cristae membranes by connecting them to the inner boundary membrane. Furthermore, it facilitates protein import via the mitochondrial intermembrane space assembly (MIA) pathway.
Database Links
Protein Families
MICOS complex subunit Mic60 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is Fcj1 and what is its role in mitochondrial structure of Aspergillus niger?

Fcj1 (Formation of Crista Junction protein 1) is a mitochondrial membrane protein that plays a crucial role in the formation and maintenance of crista junctions (CJs) in mitochondria. In Aspergillus niger, Fcj1 (UniProt ID: A2QI68) is also known as mic60, An04g02460, or MICOS complex subunit mic60 .

The protein functions primarily at crista junctions, which are important structural features where the inner boundary membrane connects with the cristae membrane. Research on yeast orthologs shows that Fcj1 is specifically enriched at these junctions and is essential for their formation . The absence of Fcj1 leads to a complete loss of crista junctions, resulting in concentric stacks of inner membrane within the mitochondrial matrix . This architectural role is fundamental to maintaining proper mitochondrial function.

How does Fcj1 in Aspergillus niger compare to homologs in other species?

Fcj1 in Aspergillus niger shares limited sequence identity with its homologs in other organisms - approximately 13% with human mitofilin and 12% with mouse mitofilin . Despite this low sequence conservation, key structural features are preserved across species:

SpeciesProtein NameSequence Identity with A. niger Fcj1Conserved Features
Aspergillus nigerFcj1/Mic60100%N-terminal transmembrane segment, coiled-coil domain, C-terminal conserved region
HumanMitofilin~13%Similar domain architecture, higher conservation in C-terminus
MouseMitofilin~12%Similar domain architecture, higher conservation in C-terminus
Saccharomyces cerevisiaeFcj1Higher than human/mouseSimilar functional properties in MICOS complex

The C-terminal segment shows higher conservation across species, suggesting this region is particularly important for the protein's function . Despite sequence divergence, the functional role in cristae organization appears to be conserved across eukaryotes, indicating its fundamental importance in mitochondrial architecture.

What is the predicted structure and subcellular localization of Aspergillus niger Fcj1?

Aspergillus niger Fcj1 is a protein of approximately 631 amino acids with several key structural features:

  • An N-terminal mitochondrial targeting sequence with a high probability (0.9967) for mitochondrial localization as predicted by MitoProt II

  • A predicted cleavage site of the mitochondrial processing peptidase between positions 16 and 17

  • A possible mitochondrial intermediate peptidase cleavage site between residues 24 and 25

  • A single transmembrane segment near the N-terminus

  • A coiled-coil domain important for protein-protein interactions

  • A conserved C-terminal domain that may be involved in specific functions related to crista junction formation

Subcellular fractionation experiments confirm that Fcj1 is exclusively localized to mitochondria. The protein is resistant to proteinase K digestion in intact mitochondria but becomes susceptible after selective opening of the outer membrane, indicating that it is anchored in the inner mitochondrial membrane with domains extending into the intermembrane space .

What are the optimal expression systems for producing recombinant Aspergillus niger Fcj1?

Based on current research, E. coli has been successfully used as an expression system for recombinant Aspergillus niger Fcj1 . The methodological approach involves:

  • Gene synthesis or cloning of the Aspergillus niger fcj1 gene (excluding the mitochondrial targeting sequence)

  • Insertion into an appropriate expression vector with a His-tag for purification

  • Expression in E. coli under optimized conditions

Expression considerations:

  • The mature protein form (amino acids 48-631) is typically used to avoid issues with the mitochondrial targeting sequence

  • N-terminal His-tagging has been demonstrated to be effective for purification without compromising protein function

  • Expression at lower temperatures (16-20°C) may improve protein folding and solubility

  • Codon optimization for E. coli may be necessary given the different codon usage between fungi and bacteria

Alternative expression systems such as yeast (Pichia pastoris) may be considered for cases where post-translational modifications are essential for functional studies.

How can researchers optimize the purification of recombinant Fcj1?

The purification of recombinant Fcj1 requires careful consideration of its biochemical properties:

Recommended purification protocol:

  • Cell lysis: Use gentle lysis methods to preserve protein structure, such as sonication in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, and protease inhibitors

  • Initial purification: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

  • Intermediate purification: Ion exchange chromatography to remove contaminants

  • Final purification: Size exclusion chromatography to obtain pure, monodisperse protein

  • Storage: In Tris/PBS-based buffer with 6% trehalose at pH 8.0

Critical considerations:

  • Membrane proteins like Fcj1 may require detergents for solubilization; mild detergents such as DDM (n-Dodecyl β-D-maltoside) at 0.03-0.05% can maintain protein structure

  • Addition of 5-50% glycerol to the final formulation can improve stability during storage

  • Aliquoting and storage at -20°C/-80°C is recommended to avoid repeated freeze-thaw cycles

  • Reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL

What techniques are most effective for studying Fcj1 localization and interactions in mitochondria?

Several complementary techniques have proven effective for studying Fcj1 localization and interactions:

  • Immunogold electron microscopy:

    • Most precise method for determining the specific localization of Fcj1 at crista junctions

    • Requires chemical fixation of cells followed by cryosectioning and immunolabeling with Fcj1-specific antibodies

    • Statistical analysis of gold particle distribution can quantitatively demonstrate enrichment at crista junctions relative to other mitochondrial compartments

  • Biochemical fractionation:

    • Differential centrifugation to isolate mitochondria

    • Subfractionation of mitochondrial membranes to separate inner boundary membrane from cristae membrane

    • Western blotting analysis to detect Fcj1 in different fractions

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify interacting partners

    • Blue native PAGE to analyze Fcj1 participation in protein complexes

    • Crosslinking mass spectrometry to map interaction interfaces

  • Functional genomics approaches:

    • Gene deletion studies to assess phenotypic consequences

    • Complementation assays to verify functional conservation between species

How does Fcj1 interact with and regulate F1FO-ATP synthase in Aspergillus niger?

Research indicates a complex regulatory relationship between Fcj1 and F1FO-ATP synthase that impacts mitochondrial ultrastructure:

  • Antagonistic relationship:

    • Fcj1 and F1FO-ATP synthase seem to exert opposing effects on membrane curvature

    • While Fcj1 promotes negative curvature at crista junctions, F1FO-ATP synthase dimers promote positive curvature at cristae tips

  • Regulation of F1FO-ATP synthase oligomerization:

    • Deletion of Fcj1 results in increased levels of F1FO-ATP synthase supercomplexes

    • Overexpression of Fcj1 leads to reduced levels of these supercomplexes

  • Spatial distribution relationship:

    • Quantitative immunoelectron microscopy reveals that Fcj1 is enriched at crista junctions

    • In contrast, F1FO-ATP synthase subunits are more concentrated at cristae tips

    • This spatial separation suggests a model where local enrichment of Fcj1 prevents F1FO-ATP synthase oligomerization at crista junctions

  • Functional interaction with F1FO-ATP synthase subunits e and g:

    • Genetic interaction studies show that Fcj1 and subunits e/g of F1FO-ATP synthase (involved in dimer formation) functionally interact

    • Deletion of these subunits causes enlargement of crista junction diameter and promotes cristae branching, similar to Fcj1 overexpression

This intricate relationship appears to be evolutionarily conserved across eukaryotes, as similar interactions have been observed in organisms as divergent as yeast and Trypanosoma brucei, which separated approximately 2 billion years ago .

How can Fcj1 research contribute to understanding mitochondrial dynamics in filamentous fungi?

Studying Fcj1 in Aspergillus niger offers unique insights into mitochondrial dynamics in filamentous fungi:

  • Hyphal growth and mitochondrial distribution:

    • Filamentous fungi have unique cellular organization with rapidly extending hyphal tips

    • Research into Fcj1 function can reveal how mitochondrial architecture adapts to support this growth pattern

    • The relationship between mitochondrial ultrastructure and efficient ATP production during hyphal extension remains poorly understood

  • Metabolic adaptation:

    • A. niger is known for its metabolic versatility and ability to grow on diverse carbon sources

    • Central carbon metabolism in A. niger involves complex pathways that process both 5- and 6-carbon sugars

    • Understanding how mitochondrial architecture (regulated by Fcj1) responds to different carbon sources could provide insights into metabolic engineering

  • Comparative analysis across fungal species:

    • Genomic studies of A. niger have advanced significantly since the first genome sequence was published in 2007

    • Comparative analysis of Fcj1 across different Aspergillus species could reveal adaptations related to their ecological niches

    • Such studies could leverage the growing number of high-quality genome sequences available for Aspergillus species

What methodological approaches are most effective for studying the effects of Fcj1 deletion or overexpression in Aspergillus niger?

To effectively study the consequences of Fcj1 deletion or overexpression in A. niger, researchers should consider these methodological approaches:

  • Genetic manipulation strategies:

    • CRISPR-Cas9 gene editing for precise deletion of fcj1 or specific domains

    • Inducible expression systems (such as tetracycline-inducible or alcohol-inducible promoters) for controlled overexpression

    • Complementation with wild-type or mutant versions to confirm phenotype specificity

  • Phenotypic characterization:

    • Electron microscopy to assess mitochondrial ultrastructure, particularly cristae organization

    • Fluorescence microscopy with mitochondrial markers to monitor changes in mitochondrial network morphology

    • Growth assays under different carbon sources to assess metabolic consequences

    • Stress response tests (oxidative, osmotic, temperature) to evaluate mitochondrial resilience

  • Molecular and biochemical analysis:

    • Blue native PAGE to analyze changes in respiratory chain and F1FO-ATP synthase complex assembly

    • Respirometry to measure oxygen consumption rates and mitochondrial function

    • Metabolomics to assess changes in TCA cycle intermediates and other mitochondria-related metabolites

    • Proteomics to identify compensatory changes in the mitochondrial proteome

  • Multi-omics integration:

    • Combined analysis of transcriptome, proteome, and metabolome data to understand cellular responses

    • This approach has been successfully used to validate central carbon metabolic models in A. niger

How does Fcj1 contribute to the MICOS complex in Aspergillus niger?

Fcj1 (also known as Mic60) is a core component of the Mitochondrial Contact Site and Cristae Organization System (MICOS) complex. In Aspergillus niger, its role within this complex can be understood through several lines of evidence:

  • MICOS complex composition:

    • Fcj1/Mic60 serves as a core subunit of the MICOS complex

    • The complex likely contains other conserved subunits like Mic10, though the complete composition in A. niger has not been fully characterized

    • Research in other organisms suggests that the MICOS complex functions as a large protein assembly that stabilizes crista junctions

  • Evolutionary conservation of MICOS-F1FO-ATP synthase crosstalk:

    • Studies in Trypanosoma brucei show that the interaction between MICOS components and F1FO-ATP synthase is conserved across evolutionary distant organisms

    • This suggests that in A. niger, Fcj1 likely participates in similar interactions as part of the MICOS complex

  • Functional significance:

    • The MICOS complex is essential for maintaining proper cristae architecture

    • It promotes negative membrane curvature at crista junctions

    • The complex serves as an organizing center for protein assemblies in the mitochondrial inner membrane

  • Potential interactions with other mitochondrial systems:

    • MICOS may interact with components of the protein import machinery

    • It might play a role in the organization of respiratory chain complexes

    • Connection with lipid transfer systems between mitochondrial membranes is possible

How can Fcj1 research inform metabolic engineering strategies for Aspergillus niger?

Understanding Fcj1's role in mitochondrial architecture offers several potential applications for metabolic engineering of Aspergillus niger:

  • Optimization of citric acid production:

    • A. niger is an important industrial producer of citric acid

    • Mitochondrial function is directly linked to TCA cycle activity and citric acid accumulation

    • Modulating Fcj1 expression could potentially influence citric acid production by affecting mitochondrial function

  • Enhancing heterologous protein production:

    • A. niger is utilized as a host for heterologous protein expression

    • Energy metabolism, which depends on mitochondrial function, is crucial for supporting high-level protein production

    • Engineering mitochondrial architecture through Fcj1 modulation might improve cellular energetics for protein production

  • Improving stress tolerance:

    • Industrial fermentation processes often expose A. niger to multiple stresses

    • Mitochondria are central to cellular stress responses

    • Understanding how Fcj1 contributes to mitochondrial adaptation under stress could inform engineering strategies for more robust industrial strains

  • Integration with central carbon metabolism models:

    • Researchers have developed models of central carbon metabolism in A. niger

    • Incorporating knowledge about how mitochondrial ultrastructure (regulated by Fcj1) affects metabolism could enhance these models

    • This integration could lead to more accurate predictions for metabolic engineering interventions

Engineering TargetPotential Fcj1-Related StrategyExpected Outcome
Citric acid productionFine-tuning Fcj1 expression to optimize mitochondrial functionEnhanced TCA cycle activity and improved citric acid yields
Protein secretionEngineering mitochondrial architecture to support high ATP productionIncreased energy availability for protein synthesis and secretion
Stress toleranceStabilizing mitochondrial ultrastructure through Fcj1 modificationsImproved strain performance under industrial conditions
Carbon source utilizationOptimizing cristae architecture for efficient respiratory metabolismBetter growth and product formation on diverse carbon sources

What are the most promising future research directions for Fcj1 in Aspergillus niger?

Several promising research directions could significantly advance our understanding of Fcj1 in Aspergillus niger:

  • Comprehensive characterization of the MICOS complex:

    • Identification of all MICOS components in A. niger

    • Understanding the assembly pathway of the complex

    • Mapping protein-protein interactions within the complex and with other mitochondrial systems

  • Cryo-electron tomography of mitochondrial ultrastructure:

    • High-resolution 3D visualization of crista junctions in wild-type and fcj1 mutants

    • Comparison of mitochondrial architecture across different growth conditions

    • Correlation of ultrastructural features with metabolic states

  • Systems biology approaches:

    • Integration of proteomics, metabolomics, and mitochondrial functional data

    • Development of mathematical models describing the relationship between cristae architecture and metabolic efficiency

    • Network analysis to understand how Fcj1/MICOS is integrated within the larger cellular system

  • Comparative genomics and evolution:

    • Analysis of Fcj1 sequence and functional evolution across fungal species

    • Identification of lineage-specific adaptations in Fcj1 structure and function

    • Understanding how Fcj1 co-evolved with other mitochondrial proteins, particularly F1FO-ATP synthase components

  • Biotechnological applications:

    • Development of Fcj1-based tools for modulating mitochondrial function in industrial strains

    • Exploration of Fcj1 as a target for enhancing stress resistance in industrial bioprocesses

    • Investigation of whether Fcj1 modulation can improve the production of secondary metabolites of interest

  • Role in pathogenicity:

    • While A. niger is generally considered non-pathogenic, it can cause opportunistic infections

    • Understanding whether Fcj1 contributes to survival under host-imposed stresses could provide insights into fungal pathogenicity mechanisms

    • Comparative studies with pathogenic Aspergillus species might reveal differences relevant to virulence

These research directions would not only advance our fundamental understanding of mitochondrial biology in filamentous fungi but could also lead to practical applications in biotechnology and medicine.

What are the main technical challenges in studying mitochondrial ultrastructure in Aspergillus niger?

Investigating mitochondrial ultrastructure in Aspergillus niger presents several unique technical challenges:

  • Sample preparation complexities:

    • The rigid fungal cell wall complicates fixation and infiltration procedures for electron microscopy

    • Standard protocols often require modification with enzymatic cell wall digestion or high-pressure freezing techniques

    • Preserving native mitochondrial ultrastructure during sample preparation requires careful optimization

  • Hyphal heterogeneity:

    • Different regions of the mycelium (e.g., growing tips vs. older segments) may exhibit distinct mitochondrial morphologies

    • This heterogeneity necessitates systematic sampling approaches and larger datasets for meaningful analysis

    • Correlating ultrastructural observations with specific hyphal regions/ages is methodologically challenging

  • Difficulties with genetic manipulation:

    • Although genetic tools for A. niger have improved, they remain less developed than those for model organisms like S. cerevisiae

    • Homologous recombination efficiency can be variable, complicating targeted genetic modifications

    • The multinucleate nature of fungal hyphae can result in heterokaryons after transformation, requiring careful screening

  • Live-cell imaging limitations:

    • The filamentous growth habit complicates live imaging of mitochondrial dynamics

    • Phototoxicity during extended live-cell imaging can alter mitochondrial behavior

    • Establishing systems for controlled growth during imaging requires specialized approaches

  • Integration of ultrastructural and functional data:

    • Correlating changes in cristae architecture with functional measurements presents both conceptual and technical challenges

    • Simultaneous assessment of structure and function often requires complementary approaches with different sample preparation requirements

How can researchers effectively measure the impact of Fcj1 on mitochondrial function in Aspergillus niger?

To comprehensively assess the functional impact of Fcj1 on mitochondrial physiology, researchers should employ multiple complementary approaches:

  • Respiratory capacity assessment:

    • High-resolution respirometry to measure oxygen consumption rates under different metabolic states

    • Analysis of respiratory control ratios to assess coupling efficiency

    • Substrate-inhibitor titrations to evaluate the function of specific respiratory complexes

  • Membrane potential measurements:

    • Fluorescent probes (e.g., TMRM, JC-1) to quantify mitochondrial membrane potential

    • Flow cytometry or fluorescence microscopy for single-cell or subcellular resolution

    • Time-resolved measurements to capture dynamic changes in membrane potential

  • ATP production capacity:

    • Luciferase-based assays to quantify cellular ATP levels

    • Correlation of ATP production with carbon source availability and growth conditions

    • Assessment of ATP:ADP ratios as indicators of energy charge

  • ROS production and oxidative stress:

    • Measurement of mitochondrial and cellular ROS levels using specific probes

    • Analysis of oxidative damage markers (protein carbonylation, lipid peroxidation)

    • Assessment of antioxidant enzyme activities as indicators of adaptive responses

  • Metabolic flux analysis:

    • 13C-labeled substrate incorporation to track metabolic fluxes through central carbon metabolism

    • Quantification of TCA cycle intermediates and related metabolites

    • Integration with existing metabolic models of A. niger

  • Calcium homeostasis:

    • Measurement of mitochondrial calcium uptake capacity

    • Analysis of calcium-dependent signaling in wild-type vs. fcj1 mutants

    • Assessment of calcium's role in regulating mitochondrial function in the context of Fcj1

  • mtDNA stability and maintenance:

    • Quantification of mtDNA copy number and integrity

    • Analysis of nucleoid organization and distribution

    • Assessment of mtDNA mutation rates in the presence or absence of Fcj1

Each of these approaches provides complementary insights into how Fcj1-mediated changes in mitochondrial ultrastructure translate to functional consequences for the organism's physiology and metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.