Recombinant Aspergillus niger High osmolarity signaling protein sho1 (sho1)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Aspergillus niger High Osmolarity Signaling Protein Sho1 (Sho1) is a transmembrane sensor protein critical for fungal adaptation to osmotic stress and regulation of cellular growth. Produced via heterologous expression in Escherichia coli, this protein is a key component of the High Osmolarity Glycerol (HOG) mitogen-activated protein kinase (MAPK) pathway, which governs stress responses, morphogenesis, and virulence in fungi .

Functional Role in Aspergillus niger

Sho1 regulates multiple cellular processes:

  • Osmotic Stress Response: Activates the HOG-MAPK pathway to synthesize glycerol, counteracting hyperosmotic conditions .

  • Polarized Growth: Mediates actin cytoskeleton organization and apical vesicle trafficking during hyphal elongation. Mutants exhibit delayed germination, multiple germ tubes, and irregular hyphae .

  • Oxidative Stress Adaptation: Modulates reactive oxygen species (ROS) detoxification pathways, including glutathione metabolism .

Production and Purification

Recombinant Sho1 is produced in E. coli with the following protocols :

  1. Expression: Induced with IPTG in BL21(DE3) cells.

  2. Purification: Affinity chromatography via His-tag, followed by gel filtration.

  3. Reconstitution: Lyophilized powder dissolved in Tris/PBS buffer (pH 8.0) with 6% trehalose.

  4. Quality Control: Validated by SDS-PAGE (>90% purity) and mass spectrometry.

Role in Secretory Pathways

Sho1 indirectly enhances recombinant protein secretion by modulating redox homeostasis:

  • Overexpression of glutathione-related genes (e.g., Glr1) reduces intracellular ROS by 50% and increases glucoamylase activity by 243% in A. niger .

  • The unfolded protein response (UPR) is activated under secretion stress, upregulating chaperones (e.g., BipA, PdiA) and foldases .

Transcriptional Regulation

Sho1 deficiency downregulates Rho GTPases (rho1, rho3, CDC42) by 4–5 fold, disrupting actin polarization and vesicle trafficking .

GeneExpression in sho1 Mutant (vs. Wild Type)Functional Impact
rho10.18-foldImpaired hyphal tip growth
CDC420.33-foldDisrupted Spitzenkörper vesicle clustering

Industrial and Biomedical Applications

  1. Protein Production Optimization:

    • Engineering A. niger strains with Sho1-associated redox modules (e.g., NADPH regeneration) boosts total protein secretion by 88% .

    • Constitutive UPR activation (via hacA overexpression) enhances heterologous enzyme yields .

  2. Pathogenesis Studies:

    • Sho1 homologs in A. fumigatus are linked to biofilm formation, melanin synthesis, and virulence .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing the order. We will prepare the product according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
sho1; An03g04690; High osmolarity signaling protein sho1; Osmosensor sho1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Target Names
sho1
Target Protein Sequence
MARFRASNILGDPFALASTSISILAWLIAFISSIVTGVHGGYPTYSWWAVAYSFCCIVGM ALVFGTDTGAVYNIAIVGYLSAGLVITTISINTLVYANSAASQAAGAGFILLAMVIIIWI FYFGSSPQASHRGFIDSFALQKEGAGSYGNGRPMSTAFGNRPETTSSQPPQMYTSAQLNG FETSSPVSGYPGGAPGSEHRSSSQPRFGNPSATNLPNNGAPDEVPQPTEYPYRAKAIYSY EANPEDANEISFTKHEILEVSDVSGRWWQARKATGETGIAPSNYLILL
Uniprot No.

Target Background

Function
Plasma membrane osmosensor that activates the high osmolarity glycerol (HOG) MAPK signaling pathway in response to high osmolarity.
Database Links
Protein Families
SHO1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of A. niger Sho1 protein?

Aspergillus niger Sho1 (UniProt ID: A2QGW1) is a 288-amino acid transmembrane protein with several conserved domains. Similar to Sho1 proteins in other fungi, the A. niger Sho1 likely contains four putative transmembrane domains near its N-terminus (comparable to positions 36-58, 68-87, 92-114, and 124-146 in A. fumigatus Sho1) and an SH3 domain at the C-terminus that facilitates protein-protein interactions with downstream signaling components . The recombinant version is typically expressed with an N-terminal His-tag to facilitate purification and detection in experimental systems . The complete amino acid sequence of A. niger Sho1 is: MARFRASNILGDPFALASTSISILAWLIAFISSIVTGVHGGYPTYSWWAVAYSFCCIVGMALVFGTDTGAVYNIAIVGYLSAGLVITTISINTLVYANSAASQAAGAGFILLAMVIIIWIFYFGSSPQASHRGFIDSFALQKEGAGSYGNGRPMSTAFGNRPETTSSQPPQMYTSAQLNGFETSSPVSGYPGGAPGSEHRSSSQPRFGNPSATNLPNNGAPDEVPQPTEYPYRAKAIYSY EANPEDANEISFTKHEILEVSDVSGRWWQARKATGETGIAPSNYLILL .

What is the recommended reconstitution protocol for lyophilized recombinant Sho1 protein?

For optimal reconstitution of lyophilized recombinant A. niger Sho1 protein, first centrifuge the vial briefly to bring all contents to the bottom. Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . For long-term storage, it is advisable to add glycerol to a final concentration of 5-50% (with 50% being standard practice) and aliquot before storing at -20°C/-80°C . This approach minimizes protein degradation from repeated freeze-thaw cycles. For working solutions, these aliquots can be stored at 4°C for up to one week, though repeated freezing and thawing should be avoided to maintain protein integrity .

What are the optimal storage conditions for maintaining recombinant Sho1 protein activity?

For optimal preservation of recombinant A. niger Sho1 protein activity, store the lyophilized powder at -20°C/-80°C upon receipt . After reconstitution, the protein should be aliquoted to minimize freeze-thaw cycles, as repeated freezing and thawing significantly compromises protein integrity and function . Working aliquots can be maintained at 4°C for up to one week . The storage buffer composition is critical for stability - a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0 is recommended for the reconstituted protein . For long-term storage, adding glycerol to a final concentration of 50% helps prevent protein denaturation during freezing . Always maintain sterile conditions when handling the protein to prevent microbial contamination that could lead to degradation.

How can researchers effectively use recombinant Sho1 protein in protein-protein interaction studies?

To effectively use recombinant A. niger Sho1 protein in protein-protein interaction studies, leverage the His-tag for initial purification using immobilized metal affinity chromatography (IMAC) . For pull-down assays, the His-tagged Sho1 can be immobilized on nickel or cobalt resins and used to capture potential interacting partners from cellular lysates. Based on knowledge from other fungal species, focus on components of the HOG-MAPK pathway as primary interaction candidates . The SH3 domain at the C-terminus is particularly important, as it likely mediates interactions with proline-rich regions of downstream effectors such as MAPK kinases . For co-immunoprecipitation experiments, use anti-His antibodies to pull down Sho1 complexes. Consider crosslinking approaches to stabilize transient interactions. Additionally, yeast two-hybrid screens or bimolecular fluorescence complementation can be employed to identify novel interaction partners in vivo, which can then be validated using the recombinant protein in vitro.

What experimental approaches are recommended for investigating Sho1's role in osmotic stress response?

To investigate A. niger Sho1's role in osmotic stress response, a comprehensive approach combining in vitro and in vivo methods is recommended. Begin with in vitro phosphorylation assays using the recombinant Sho1 protein and putative downstream MAPK components to assess signaling activation under various osmotic conditions . For cellular studies, generate Sho1 knockout and overexpression strains in A. niger (similar to the strategy used for A. fumigatus described in search result ). Subject these strains to osmotic challenges (e.g., high salt, sorbitol, or glycerol concentrations) and monitor growth rates, morphological changes, and stress-responsive gene expression. Phosphoproteomics can reveal modifications in the HOG-MAPK cascade components following osmotic stress. Real-time microscopy with fluorescently-tagged Sho1 can track its subcellular localization during stress responses. Compare results with data from other fungal species like S. cerevisiae, where Sho1 is a well-established osmosensor , noting that functional divergence may exist as observed in C. albicans, where Sho1 plays only a minor role in osmotic stress adaptation .

How can researchers differentiate between Sho1-dependent and Sho1-independent pathways in oxidative stress responses?

To differentiate between Sho1-dependent and Sho1-independent oxidative stress response pathways in A. niger, researchers should implement a multi-faceted approach. First, generate Sho1 deletion mutants (similar to the A. fumigatus MA21 strain described in the literature) and expose both wild-type and mutant strains to various oxidative stressors such as hydrogen peroxide (≈2.5 mM) and menadione (≈15 μM) . Measure growth inhibition, survival rates, and morphological changes to establish phenotypic differences. Complement these observations with transcriptomic analyses comparing gene expression profiles of wild-type versus Sho1-deficient strains under oxidative challenge, identifying differentially expressed genes that represent Sho1-dependent pathways. Employ phosphoproteomic analysis to map signaling cascades, distinguishing between those affected by Sho1 deletion and those that remain intact. Investigate genetic interactions by creating double knockouts of Sho1 and other stress-responsive pathway components. Based on findings in A. fumigatus, expect Sho1 to be particularly important for adaptation to specific oxidants like hydrogen peroxide and menadione, with possibly distinct or overlapping downstream effectors for each stressor .

What are the implications of Sho1's domain structure for designing functional mutants in research?

The domain architecture of Sho1 offers strategic opportunities for creating functional mutants that can elucidate specific aspects of its signaling mechanisms. The protein contains four transmembrane domains near the N-terminus and an SH3 domain at the C-terminus . When designing functional mutants, researchers should consider: (1) Transmembrane domain mutations to investigate membrane localization and stress sensing capabilities. Point mutations in these regions can disrupt protein integration into membranes or alter conformational responses to environmental stimuli. (2) SH3 domain mutations to disrupt protein-protein interactions with downstream effectors like MAPK kinases . Conservative substitutions in key residues can provide insights into binding specificity and strength. (3) Linker region modifications to examine flexibility requirements between domains. (4) Phosphorylation site mutations to evaluate post-translational regulation. Based on the successful construction of the A. fumigatus Sho1 deletion mutant (MA21) , complementation studies with domain-specific mutants can reveal which regions are essential for different Sho1 functions, such as oxidative stress resistance versus morphological regulation.

How can researchers leverage comparative genomics to understand the evolution of Sho1 function across fungal species?

To leverage comparative genomics for understanding Sho1 evolution across fungal species, researchers should begin with comprehensive sequence alignment of Sho1 proteins from diverse fungi, including A. niger, A. fumigatus, A. clavatus, A. nidulans, S. cerevisiae, and C. albicans . Identify conserved domains and species-specific variations, paying particular attention to the four transmembrane domains and the SH3 domain that are fundamental to Sho1 function . Construct phylogenetic trees to visualize evolutionary relationships and identify potential functional divergences. Map known phenotypic differences (e.g., S. cerevisiae Sho1's strong role in osmotic stress versus C. albicans Sho1's predominant role in oxidative stress and morphogenesis ) onto these trees to identify correlation patterns between sequence evolution and functional adaptation. Analyze the genomic context of sho1 genes across species, examining conservation of neighboring genes and regulatory elements. Perform synteny analysis to detect genomic rearrangements that might influence gene expression. Complement these in silico approaches with experimental validation by expressing heterologous Sho1 proteins in A. niger sho1 deletion mutants to test functional complementation across species boundaries.

What strategies can resolve inconsistent results in Sho1 functional assays?

When encountering inconsistent results in Sho1 functional assays, systematically evaluate multiple experimental factors. First, verify protein quality by assessing the purity (should be >90% by SDS-PAGE ) and integrity of your recombinant Sho1 preparation. Consider using fresh aliquots as repeated freeze-thaw cycles significantly compromise protein function . Examine buffer composition, as the recommended Tris/PBS-based buffer with 6% Trehalose at pH 8.0 may need optimization for specific applications. Standardize experimental conditions, particularly temperature, incubation times, and reagent concentrations. For cellular assays with A. niger, growth phase variability can significantly impact stress responses; synchronize cultures before experiments. If studying oxidative stress responses, note that Sho1's role may be stressor-specific as observed in A. fumigatus, which showed sensitivity to hydrogen peroxide and menadione but minimal sensitivity to diamide . For contradictory phenotypes in genetic studies, verify the genetic background of your strains and consider creating new knockout or complemented strains using different methodologies. When analyzing pathway interactions, remember that Sho1 functions in complex signaling networks with potential compensatory mechanisms that may mask phenotypes under certain conditions.

How should researchers interpret differences in Sho1-mediated phenotypes between in vitro and in vivo studies?

When interpreting discrepancies between in vitro and in vivo Sho1-mediated phenotypes, researchers must consider several key factors. First, recognize that in vitro systems lack the complex regulatory networks present in living cells. The recombinant A. niger Sho1 protein, while useful for biochemical characterization, exists without the cellular context of interacting proteins, regulatory mechanisms, and compensatory pathways . Second, examine variations in protein modifications and conformation. The recombinant His-tagged Sho1 expressed in E. coli may lack fungal-specific post-translational modifications essential for certain functions. Third, consider microenvironmental differences; the in vivo fungal membrane composition significantly affects transmembrane protein function, which cannot be replicated in many in vitro assays. For phenotypic analyses, data from A. fumigatus show that Sho1 influences multiple aspects of fungal biology, including hyphal morphology, germination rates, phialide production, and stress responses . Discrepancies might arise if in vitro studies focus on isolated biochemical properties while missing these integrated cellular effects. Additionally, pathway redundancy often leads to more subtle phenotypes in vivo than predicted by in vitro studies of isolated pathway components.

What analytical approaches best characterize the structural dynamics of Sho1 during signal transduction?

To comprehensively characterize the structural dynamics of Sho1 during signal transduction, researchers should employ multiple complementary analytical techniques. Begin with hydrogen-deuterium exchange mass spectrometry (HDX-MS) using purified recombinant Sho1 protein to map conformational changes upon ligand binding or stress stimulation. This technique reveals regions of altered solvent accessibility, providing insights into domain movements. Supplement with molecular dynamics simulations based on the known sequence of A. niger Sho1 to predict conformational shifts in response to environmental changes. For higher resolution structural analysis, X-ray crystallography or cryo-electron microscopy of Sho1 in different activation states can reveal atomic-level details of structural transitions. In cellular contexts, fluorescence resonance energy transfer (FRET) with strategically placed fluorophores can monitor real-time conformational changes in live cells. Single-molecule FRET is particularly powerful for capturing transient intermediate states. Site-directed spin labeling coupled with electron paramagnetic resonance (EPR) spectroscopy can measure distances between specific residues during signaling events. Cross-linking mass spectrometry (XL-MS) can identify dynamic interaction interfaces with binding partners, particularly relevant for understanding how the SH3 domain engages downstream effectors during signal transduction .

How should experiments be designed to compare Sho1 function across different Aspergillus species?

To effectively compare Sho1 function across different Aspergillus species, design experiments with careful attention to evolutionary context and physiological relevance. Begin with sequence alignment and domain prediction analyses of Sho1 proteins from A. niger, A. fumigatus, A. clavatus, and A. nidulans, noting the high sequence conservation already established (83% identity between A. niger and A. clavatus, 71% between A. niger and A. nidulans) . Create equivalent genetic modifications across species, including clean deletions of the sho1 gene following the methodology used for A. fumigatus , and complementation with both native and heterologous sho1 genes to test functional conservation. Subject these strains to standardized stress conditions, including oxidative stressors (hydrogen peroxide at 2.5 mM, menadione at 15 μM) , osmotic challenges, and cell wall perturbants. Compare growth rates, germination timing, hyphal morphology, and stress sensitivity using identical media compositions and growth conditions. Implement comparative transcriptomics to identify species-specific and conserved Sho1-dependent gene expression patterns under stress conditions. Analyze subcellular localization of fluorescently-tagged Sho1 proteins to detect potential differences in membrane distribution or stress-induced relocalization. For mechanistic insights, conduct comparative phosphoproteomic analyses to map species-specific differences in downstream signaling cascade activation.

What methodological considerations are important when using recombinant Sho1 protein for antibody production and validation?

When developing antibodies against recombinant A. niger Sho1 protein, several methodological considerations are crucial for success. First, carefully select immunogenic epitopes that are accessible in the native protein but avoid the transmembrane regions (four domains near the N-terminus) , which are typically embedded in membranes in vivo. The C-terminal SH3 domain and extracellular loops between transmembrane segments make ideal targets for antibody recognition. Use the highly purified (>90%) recombinant His-tagged full-length Sho1 protein for initial immunization, but consider complementing with synthetic peptides corresponding to predicted epitopes for more targeted antibody production. Implement rigorous validation protocols including: (1) Western blotting against both recombinant protein and native Sho1 from A. niger lysates; (2) Immunoprecipitation efficiency testing; (3) Specificity confirmation using sho1 deletion mutants as negative controls; (4) Cross-reactivity assessment with Sho1 proteins from related Aspergillus species; and (5) Immunolocalization studies to verify expected subcellular distribution patterns based on the transmembrane nature of Sho1. For monoclonal antibody development, screen hybridoma clones against both denatured and native conformations of the protein to select antibodies suitable for different applications such as Western blotting versus immunoprecipitation.

How does the data on Sho1 function inform our understanding of fungal adaptation mechanisms?

The functional characterization of Sho1 provides significant insights into fungal adaptation mechanisms. Studies in A. fumigatus reveal that Sho1 plays crucial roles in regulating hyphal growth, germination timing, and adaptation to oxidative stress . These findings illuminate how filamentous fungi sense and respond to environmental challenges. The involvement of Sho1 in oxidative stress responses across multiple fungal species (including S. cerevisiae and C. albicans) suggests a conserved role in protecting cells against reactive oxygen species encountered during host invasion or environmental competition. Interestingly, the data indicates functional divergence across fungal lineages - in S. cerevisiae, Sho1 primarily responds to osmotic stress, while in C. albicans, it predominantly mediates oxidative stress responses and influences morphogenesis . This evolutionary plasticity demonstrates how signaling components can be repurposed for different environmental challenges across species. The structural conservation of Sho1's transmembrane domains and SH3 domain across distantly related fungi, despite functional adaptations, exemplifies the balance between structural constraints and functional innovation in evolution. Furthermore, the connection between Sho1 and morphological regulation in A. fumigatus highlights the integration between stress response systems and developmental programs, revealing how fungi coordinate their growth with environmental conditions.

What theoretical framework best explains the observed dual role of Sho1 in stress response and morphogenesis?

The dual functionality of Sho1 in both stress response and morphogenesis can be best explained through a theoretical framework of signaling network integration and crosstalk. Based on evidence from A. fumigatus and C. albicans , Sho1 appears to function as a signaling hub that connects environmental sensing with developmental regulation. This integration likely occurs through at least three mechanisms: First, pathway bifurcation, where Sho1 activation leads to divergent downstream signaling cascades - one directing stress response gene expression and another influencing cytoskeletal organization and cell wall synthesis that affects morphology. The SH3 domain at Sho1's C-terminus likely facilitates this multiplexing by interacting with distinct effector proteins. Second, temporal coordination, where the immediate response to stress through Sho1 involves protective metabolic changes, followed by longer-term morphological adaptations that enhance survival under persistent stress conditions. The observation that A. fumigatus sho1 mutants exhibit both altered hyphal development and stress sensitivity supports this sequential response model . Third, mechanistic overlap, where certain cellular processes (particularly cell wall remodeling) are simultaneously essential for both stress resistance and morphological development. This framework explains why disruption of Sho1 in A. fumigatus impacts multiple aspects of fungal biology, including hyphal branching patterns, phialide production, and oxidative stress tolerance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.