Recombinant Aspergillus niger Mitochondrial thiamine pyrophosphate carrier 1 (tpc1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aspergillus niger Mitochondrial Thiamine Pyrophosphate Carrier 1 (TPC1)

Recombinant Aspergillus niger TPC1 is a mitochondrial carrier protein engineered for research into thiamine pyrophosphate (TPP) transport across the inner mitochondrial membrane. TPC1 belongs to the mitochondrial carrier family (MCF), which facilitates the exchange of metabolites, cofactors, and nucleotides between mitochondria and cytosol . Its recombinant form is produced in heterologous systems (e.g., E. coli, mammalian cells) to study its biochemical properties, structural dynamics, and regulatory mechanisms .

Protein Structure

TPC1 contains two non-equivalent Shaker-like pore domains (Domain I and II), each with voltage-sensing domains (VSDI and VSDII) and a central EF-hand calcium-binding motif . These domains regulate ion conductance (Na⁺, Ca²⁺) and pH sensitivity. The protein forms a dimeric structure (~100Å × 70Å) with a cytoplasmic N-terminal domain (NTD) and C-terminal domain (CTD) .

Transport Function

  • Substrate Specificity: Recombinant TPC1 transports TPP and pyrophosphate (PPi) via an exchange mechanism, with ATP/ADP acting as counterions .

  • Regulation: Activity is modulated by cytosolic Ca²⁺ (via EF-hand domains) and luminal pH. Phosphorylation sites in the NTD and CTD influence Ca²⁺-dependent activation .

Production Systems

Host SystemExpression VectorTag TypePuritySource
E. colipET-basedN-terminal His>85% (SDS-PAGE)
Mammalian CellsNot specifiedNot specified>85% (SDS-PAGE)
S. cerevisiaeCell-freeN/A>85% (SDS-PAGE)

Purification Workflow

  1. Solubilization: Proteins are extracted using detergents (e.g., DDM) and lipids (soy polar lipids) .

  2. Chromatography: Size exclusion (Superose 6) and ion exchange (Ni-NTA) are employed for purification .

  3. Crystallization: Partial dehydration and relipidation optimize crystal growth for structural studies .

Functional Studies

  • Ion Transport: Recombinant Drosophila TPC1 (homologous to A. niger TPC1) imports TPP into mitochondria via ATP/ADP exchange .

  • pH Sensitivity: Luminal Ca²⁺ and low pH inhibit TPC1 activity, critical for maintaining mitochondrial pH homeostasis .

Table 2: Key Functional Parameters

ParameterValue/DescriptionSource
Substrate AffinityTPP > PPi > ATP/ADP
Optimal pH4.5–7.0 (cytosolic Ca²⁺-dependent)
InhibitorsNED19 (allosteric clamp), luminal Ca²⁺

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
tpc1; An15g03200; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-321
Protein Length
full length protein
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Target Names
tpc1
Target Protein Sequence
MSAGGEHLKDEGTRRQVVLAGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPISHRDVTG PIYKGTLSTMRDIIRQEGITGLWKGNIPAELMYVCYGVIQFSAYRTTTQALAQLDTYRLP PSAESFVAGATAGGLATASTYPLDLLRTRFAAQGTDRVYTSLMSSVRDIARNEGYAGFFR GCSAAVGQIVPYMGLFFATYEALRPPLAQYQDLPFGSGDAAAGVIASVSSKTVMFPLDLI RKRLQVQGPTRQLYIHRNIPEYQGVFNTMKLILRTQGIRGLYRGLTVSLFKAAPASAVTM WTYETSLRLLQDMEVATSKED
Uniprot No.

Target Background

Function
Mitochondrial transporter that mediates the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of Mitochondrial Thiamine Pyrophosphate Carrier 1 (tpc1) in Aspergillus niger?

Based on knowledge from related fungal species, tpc1 in A. niger likely mediates the transport of thiamine pyrophosphate (ThPP) across the inner mitochondrial membrane. ThPP is synthesized in the cytosol by thiamine pyrophosphokinase and must be transported into mitochondria to serve as an essential cofactor for several mitochondrial enzymes. In Saccharomyces cerevisiae, the tpc1 homolog (encoded by YGR096w) has been shown to catalyze both uniport (single substrate transport) and exchange mechanisms for ThPP and thiamine monophosphate (ThMP) . The protein belongs to the mitochondrial carrier family, characterized by structural features including six transmembrane domains and three mitochondrial carrier protein signature motifs.

Which mitochondrial enzymes in Aspergillus niger depend on thiamine pyrophosphate as a cofactor?

Several key mitochondrial enzymes require ThPP as a cofactor, similar to what has been documented in other fungi:

  • Acetolactate synthase (ALS): Catalyzes the first step in the biosynthesis of branched-chain amino acids (isoleucine, valine, and leucine). In S. cerevisiae, ALS activity is significantly reduced in tpc1-deficient cells grown in thiamine-depleted media, with activity restored upon addition of ThPP .

  • Pyruvate dehydrogenase complex: Converts pyruvate to acetyl-CoA, linking glycolysis to the tricarboxylic acid (TCA) cycle.

  • Oxoglutarate dehydrogenase (OGDH): Catalyzes the conversion of α-ketoglutarate to succinyl-CoA in the TCA cycle. OGDH activity has been shown to decrease 4-fold in tpc1-deficient yeast cells .

The activity of these enzymes can be assayed to indirectly assess mitochondrial ThPP levels and, by extension, tpc1 function in A. niger.

How does tpc1 deficiency manifest phenotypically in Aspergillus niger?

While specific information for A. niger is limited in the available data, extrapolating from S. cerevisiae studies suggests that tpc1 deficiency would likely result in:

  • Thiamine auxotrophy, particularly when grown on fermentative carbon sources. In yeast, tpc1-deficient cells require exogenous thiamine for growth .

  • Reduced activity of ThPP-dependent mitochondrial enzymes, including acetolactate synthase and oxoglutarate dehydrogenase. This reduction can be reversed by adding ThPP directly to enzyme assay mixtures .

  • Altered carbon source utilization patterns, as ThPP-dependent enzymes are critical for central carbon metabolism.

  • Potential impacts on growth and morphology, as observed in A. niger strains with other metabolic deficiencies. The antifungal peptide AnAFP, for example, has been shown to affect growth and morphology of A. niger when overexpressed, suggesting that metabolic perturbations can have significant phenotypic consequences .

What expression systems are most effective for producing recombinant Aspergillus niger tpc1?

Several expression systems can be employed for recombinant production of A. niger tpc1, each with distinct advantages:

  • Bacterial expression systems: The yeast tpc1 has been successfully overexpressed in bacteria, reconstituted into phospholipid vesicles, and functionally characterized . For A. niger tpc1, a similar approach using E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) would be a reasonable starting point. Expression vectors should include:

    • Strong inducible promoters (T7)

    • Fusion tags for purification (His6, GST)

    • Potentially fusion partners to enhance solubility

  • Homologous expression in A. niger: For authentic post-translational modifications, expression in A. niger itself using controlled expression systems is advantageous. The doxycycline-responsive Tet-on expression system has been successfully implemented in A. niger and allows for tight regulation of gene expression . This system enables:

    • Conditional expression (0-20 μg/mL doxycycline)

    • Studies of both null and overexpression phenotypes

    • Integration of fluorescent protein tags for localization studies

  • Other fungal expression systems: Pichia pastoris offers high cell density cultivation and strong, inducible expression promoters (AOX1) that may be suitable for producing functional fungal membrane proteins.

What protocol should be followed for functional reconstitution of purified recombinant tpc1 into liposomes?

Functional reconstitution of tpc1 into liposomes requires careful attention to detail:

Materials required:

  • Purified recombinant tpc1 protein (1-5 mg/mL)

  • Phospholipid mixture (typically including phosphatidylcholine and phosphatidylethanolamine)

  • Detergent (e.g., n-dodecyl-β-D-maltoside or Triton X-100)

  • Bio-Beads or equivalent for detergent removal

  • Appropriate buffer (pH 6.8-7.4)

Procedure:

  • Prepare lipid mixture by dissolving phospholipids in chloroform, drying under nitrogen, and rehydrating in buffer.

  • Solubilize lipids with detergent to form mixed micelles.

  • Add purified tpc1 to the lipid-detergent mixture at protein:lipid ratios between 1:50 and 1:200 (w/w).

  • Remove detergent gradually using Bio-Beads or by controlled dialysis.

  • Harvest proteoliposomes by ultracentrifugation.

  • Resuspend in appropriate buffer for transport assays.

This approach, similar to that used for reconstitution of yeast tpc1 , preserves the native conformation and transport activity of the protein. The reconstituted proteoliposomes can then be used for transport assays using radiolabeled substrates to determine kinetic parameters of transport.

How can the functionality of recombinant tpc1 be verified after purification?

Verifying the functionality of purified recombinant tpc1 involves multiple complementary approaches:

  • Transport assays with reconstituted proteoliposomes:

    • Loading proteoliposomes with buffer

    • Adding radiolabeled ThPP externally

    • Measuring uptake over time by filtration and scintillation counting

    • Calculating transport rates and comparing to known parameters

  • Substrate competition experiments:

    • Performing transport assays in the presence of potential substrates

    • Determining inhibition profiles to confirm substrate specificity

    • Comparing with known profiles from related transporters

  • Complementation assays:

    • Expressing recombinant tpc1 in tpc1-deficient yeast

    • Testing restoration of growth on thiamine-deficient media

    • Measuring rescue of ThPP-dependent enzyme activities

  • Binding assays:

    • Using isothermal titration calorimetry or microscale thermophoresis

    • Measuring direct binding of ThPP to purified protein

    • Determining affinity constants

A fully functional tpc1 should transport ThPP and ThMP efficiently while showing limited or no transport of unrelated compounds, consistent with the specificity profile observed for the S. cerevisiae homolog .

What experimental approaches can quantitatively characterize thiamine pyrophosphate transport kinetics of recombinant tpc1?

Quantitative characterization of tpc1 transport kinetics requires rigorous methodological approaches:

  • Radioisotope uptake assays:

    • Reconstitute purified tpc1 into liposomes

    • Initiate transport using [³H] or [¹⁴C]-labeled ThPP

    • Terminate transport at defined time points (5s to 30min)

    • Separate liposomes from external medium by filtration

    • Measure internalized radioactivity by scintillation counting

    • Plot initial rates against substrate concentration to determine Km and Vmax

  • Counterflow assays to determine exchange properties:

    • Preload liposomes with unlabeled substrate

    • Initiate transport with radiolabeled substrate

    • Compare uptake rates with control liposomes

    • Determine whether tpc1 operates in exchange mode like the yeast homolog

  • Temperature dependence studies:

    • Measure transport rates at multiple temperatures (4-37°C)

    • Create Arrhenius plots to determine activation energy

    • Infer mechanistic details from thermodynamic parameters

  • pH dependence analysis:

    • Conduct transport assays across pH range (5.5-8.0)

    • Determine optimal pH and potential proton coupling

    • Identify key ionizable residues through mutagenesis

Table 1: Example of expected kinetic parameters for A. niger tpc1 based on yeast homolog:

ParameterThPPThMPOther nucleotides
Km (μM)20-5040-100>500
Vmax (nmol/min/mg)50-10030-70<10
Transport modeUniport/ExchangeUniport/ExchangeLimited transport
Inhibition by CAT*NoNoNo

*CAT: carboxyatractyloside, an inhibitor of the ADP/ATP carrier that does not affect tpc1

How can substrate specificity of tpc1 be comprehensively characterized?

A comprehensive characterization of tpc1 substrate specificity requires a systematic approach:

  • Transport assays with a panel of potential substrates:

    • Thiamine derivatives: ThPP, ThMP, thiamine

    • Structurally related compounds: Other pyrophosphate-containing compounds

    • Common mitochondrial metabolites: Nucleotides, cofactors, intermediates

  • Competition assays:

    • Measure inhibition of [³H]ThPP transport by unlabeled compounds

    • Determine IC₅₀ values for each potential competitor

    • Construct a specificity profile ranking compounds by inhibitory potency

  • Structure-activity relationship analysis:

    • Test systematic modifications of the thiamine molecule

    • Determine essential structural elements for transport

    • Create a pharmacophore model for substrate recognition

  • Electrophysiological studies:

    • Reconstitute tpc1 in planar lipid bilayers

    • Measure currents associated with transport

    • Determine charge movement and coupling ratios

Based on studies with the yeast homolog, A. niger tpc1 would likely transport ThPP and ThMP efficiently while showing minimal transport of free thiamine, nucleosides, purines, and pyrimidines . The substrate specificity pattern provides important insights into the evolutionary conservation of transport function across fungal species.

What methods can identify critical residues for substrate binding and transport in tpc1?

Identifying functionally important residues requires integrating computational predictions with experimental validation:

  • Sequence-based approaches:

    • Multiple sequence alignment of tpc1 homologs across fungal species

    • Identification of absolutely conserved residues

    • Detection of co-evolving residue networks

  • Structural modeling and docking:

    • Homology modeling based on related transporters with known structures

    • In silico docking of ThPP to predict binding sites

    • Molecular dynamics simulations to identify conformational changes

  • Systematic mutagenesis:

    • Alanine-scanning mutagenesis of predicted important residues

    • Charge-reversal mutations at potential substrate interaction sites

    • Conservative vs. non-conservative substitutions to probe specific interactions

  • Functional analysis of mutants:

    • Transport assays with reconstituted mutant proteins

    • Determination of altered Km, Vmax, or substrate specificity

    • Binding assays to distinguish between binding and translocation defects

  • Accessibility studies:

    • Cysteine-scanning mutagenesis combined with thiol-specific labeling

    • State-dependent accessibility to determine conformational changes

    • Cross-linking experiments to capture specific conformational states

This integrated approach can generate a detailed structure-function map of tpc1, identifying residues involved in substrate recognition, binding, and translocation.

How does Aspergillus niger tpc1 compare functionally with homologs in Saccharomyces cerevisiae and other fungi?

Comparative functional analysis reveals evolutionary conservation and specialization in fungal tpc1 proteins:

  • Sequence comparison:

    • The yeast tpc1 (YGR096w) is well-characterized and serves as a reference point

    • Sequence identity between fungal tpc1 proteins typically ranges from 30-60%

    • Conservation is highest in transmembrane domains and substrate-binding regions

  • Functional parameters:

    • Transport kinetics (Km, Vmax) may vary reflecting metabolic differences between species

    • Substrate specificity profiles may show subtle differences in secondary substrates

    • Regulatory mechanisms might differ based on species-specific metabolic needs

  • Physiological context:

    • Yeast tpc1-deficient cells show thiamine auxotrophy on fermentative carbon sources

    • A. niger, being more filamentous and aerobic , may show different phenotypic manifestations

    • Connection to developmental processes may be more pronounced in A. niger, as suggested by the role of other proteins in nutrient-responsive development

  • Complementation capability:

    • Cross-species expression can test functional conservation

    • The human deoxynucleotide carrier (DNC), despite being the closest sequence homolog to yeast tpc1, cannot complement the thiamine auxotrophy of tpc1-deficient yeast

    • The complementation abilities of A. niger tpc1 would reveal its functional compatibility with other fungal systems

How can relationships between structure and function in tpc1 be established through evolutionary analysis?

Evolutionary analysis provides powerful insights into structure-function relationships:

  • Phylogenetic analysis approach:

    • Construct maximum likelihood trees of tpc1 sequences from diverse fungi

    • Map functional data onto the phylogenetic tree

    • Identify clades with potential functional specialization

    • Correlate sequence divergence with ecological and metabolic adaptations

  • Selection pressure analysis:

    • Calculate site-specific evolutionary rates (dN/dS)

    • Identify residues under positive or purifying selection

    • Correlate selection patterns with functional domains

  • Ancestral sequence reconstruction:

    • Infer ancestral tpc1 sequences at key evolutionary nodes

    • Express and characterize ancestral proteins

    • Determine which functional changes accompanied evolutionary transitions

  • Co-evolution network analysis:

    • Identify networks of co-evolving residues

    • Map these networks onto structural models

    • Infer functional coupling between residues

This evolutionary perspective can reveal which aspects of tpc1 function have been conserved over long evolutionary timescales (likely essential for basic transport) versus those that have diversified (potentially related to species-specific adaptations).

What is the relationship between tpc1 and other mitochondrial carrier family proteins in Aspergillus niger?

Understanding tpc1 in the context of the wider mitochondrial carrier family provides broader functional insights:

  • Genomic context:

    • S. cerevisiae contains 35 members of the mitochondrial carrier family, with all but one located in mitochondrial inner membranes

    • A. niger likely has a similar complement of carriers with specialized functions

    • Genomic clustering or co-regulation patterns may reveal functional relationships

  • Structural comparison:

    • All mitochondrial carriers share a basic structure of six transmembrane domains

    • Comparative modeling can identify unique features of tpc1 versus other carriers

    • Substrate-binding sites often show the highest divergence between carriers

  • Functional overlap:

    • Potential redundancy or complementation between related carriers

    • Differential expression patterns suggesting metabolic specialization

    • Creation of synthetic phenotypes when multiple carriers are disrupted

  • Evolutionary trajectory:

    • Analysis of gene duplication events in the history of mitochondrial carriers

    • Identification of sub-functionalization or neo-functionalization events

    • Correlation of carrier diversification with metabolic innovations

This comparative approach places tpc1 within the broader context of mitochondrial metabolite transport systems, revealing how specialization for ThPP transport evolved within the mitochondrial carrier family.

How can CRISPR-Cas9 genome editing be applied to study tpc1 function in Aspergillus niger?

CRISPR-Cas9 technology offers precise genome manipulation capabilities for studying tpc1:

  • Gene deletion strategy:

    • Design of guide RNAs targeting the tpc1 coding sequence

    • Construction of repair templates containing selection markers

    • Transformation protocol optimized for A. niger

    • Screening of transformants using PCR and Southern blotting

    • Phenotypic characterization focusing on ThPP-dependent processes

  • Endogenous tagging approaches:

    • C-terminal fusion with fluorescent proteins (GFP, mCherry) for localization

    • Addition of epitope tags (FLAG, HA) for interaction studies

    • Introduction of split fluorescent protein tags for proximity studies

    • Creation of conditional degron-tagged alleles for temporal control

  • Point mutation introduction:

    • Targeting conserved residues predicted to be important for transport

    • Creating phosphorylation-mimetic or phosphorylation-deficient mutants

    • Engineering substrate specificity variants

    • Introduction of mutations associated with altered function in homologs

  • Promoter engineering:

    • Replacement of native promoter with titratable systems like Tet-on

    • Integration of reporters under native promoter control

    • Creation of synthetic circuits connecting tpc1 expression to specific signals

The Tet-on expression system has been successfully used in A. niger to study protein function through controlled expression , suggesting that similar approaches would be effective for tpc1 functional studies.

How does tpc1 activity integrate with broader mitochondrial function and cellular metabolism in Aspergillus niger?

Understanding the integration of tpc1 in cellular metabolism requires systems-level approaches:

  • Metabolomic analysis:

    • Comparative metabolomics of wild-type and tpc1-deficient strains

    • Flux analysis using 13C-labeled substrates

    • Identification of metabolic bottlenecks created by ThPP limitation

    • Integration of data into genome-scale metabolic models

  • Transcriptomic responses:

    • RNA-seq analysis of tpc1-deficient strains

    • Identification of compensatory pathways activated upon ThPP limitation

    • Correlation with stress response networks

    • Comparison with transcriptional changes observed during nutrient limitation

  • Mitochondrial function assessment:

    • Respirometry to measure oxygen consumption rates

    • Membrane potential measurement using fluorescent probes

    • ATP production capacity

    • Morphological analysis using electron microscopy

  • Developmental connections:

    • Impact on conidiation and other developmental processes

    • Connection to nutrient sensing pathways

    • Potential links to autophagic recycling during nutrient limitation, as observed for other A. niger proteins

This integrated analysis would reveal how tpc1-mediated ThPP transport coordinates with broader cellular processes, particularly during transitions between nutrient states.

What role might tpc1 play in fungal adaptation to environmental stresses?

The role of tpc1 in stress adaptation can be investigated through:

  • Stress response profiling:

    • Growth of wild-type vs. tpc1-deficient strains under various stresses (oxidative, osmotic, temperature)

    • Measurement of stress response gene activation

    • Assessment of metabolic remodeling during stress adaptation

    • Determination of whether ThPP transport becomes limiting under stress conditions

  • Carbon source utilization:

    • Growth profiling on diverse carbon sources requiring different metabolic pathways

    • Analysis of how tpc1 deficiency affects utilization of specific substrates

    • Determination of whether thiamine supplementation rescues growth defects

    • Comparison with utilization patterns of other nutrient-responsive mutants

  • Starvation responses:

    • Analysis of tpc1 expression during carbon, nitrogen or phosphate limitation

    • Connection to starvation-induced developmental processes

    • Role in autophagy and nutrient recycling pathways

    • Comparison with other proteins involved in nutrient mobilization, such as AnAFP

  • Spatial expression patterns:

    • Visualization of tpc1 expression in different regions of fungal colonies

    • Correlation with metabolic zonation patterns

    • Potential concentration at the growing edge or in nutrient-depleted regions

    • Comparison with expression patterns of other transporters and metabolic enzymes

Understanding how tpc1 contributes to stress adaptation may reveal new aspects of mitochondrial metabolism in environmental resilience and provide insights into fungal survival strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.