Recombinant Aspergillus niger NADH-cytochrome b5 reductase 1 (cbr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
cbr1; An02g04860; NADH-cytochrome b5 reductase 1; Microsomal cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Target Names
cbr1
Target Protein Sequence
MSAFSPENITGAFIPSALFVAGTFFFKQELTPFAVALAAVLVGWKVFSNKPRKVLNPGDF QHFTLKEKNDISHNVTVYRFALPRPTDILGLPIGQHISLAATIGGKEVVRSYTPISSDNE AGYFDLLVKAYPQGNISKYLTTLEVGQTMKVRGPKGAMVYTPNMCRHIGMIAGGTGITPM YQIIKAIIRNRPRNGGNDTTQVDLIFANVNPDDILMKDELEQLAKEDDGFRIYYVLNNPP EGWTGGVGFVTPDMIKERLPAPSSDIKVLLCGPPPMVSAMKKATESLGYTKARPVSKLED QVFCF
Uniprot No.

Target Background

Function
Electron donor reductase for cytochrome b5. The cytochrome b5/NADH cytochrome b5 reductase electron transfer system supports the catalytic activity of several sterol biosynthetic enzymes.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is NADH-cytochrome b5 reductase 1 (cbr1) in Aspergillus niger?

NADH-cytochrome b5 reductase 1 (cbr1) is an enzyme that catalyzes the reduction of cytochrome b5 using NADH as an electron donor. In A. niger, this enzyme (gene ID: 4978975) is encoded by the ANI_1_682024 gene, also known as An02g04860 . The protein plays a crucial role in electron transfer processes, particularly in supporting cytochrome P450-mediated reactions. The full-length protein consists of 306 amino acids and contains domains responsible for FAD and NADH binding, which are essential for its electron transfer function.

How does cbr1 fit into the electron transport systems in fungi?

Fungi possess two primary electron-transferring systems that support cytochrome P450 enzymes: a heme-dependent cytochrome b5/cytochrome b5 reductase (Cyb5/CBR) system and a heme-independent P450 reductase (CPR) system . The cbr1 protein functions within the Cyb5/CBR pathway by accepting electrons from NADH and transferring them to cytochrome b5, which can then donate these electrons to various cytochrome P450 enzymes. This electron transfer is critical for numerous metabolic processes including ergosterol biosynthesis and xenobiotic detoxification . Unlike in some other organisms where the CPR system is dominant, in fungi like Aspergillus species, the Cyb5/CBR system can fully support certain P450-mediated reactions independently .

What expression systems are typically used for recombinant production of A. niger cbr1?

Recombinant A. niger cbr1 is commonly expressed in prokaryotic systems, particularly Escherichia coli, due to the ease of genetic manipulation and high protein yields. For functional studies, the protein is typically expressed with an N-terminal His-tag to facilitate purification . The expression construct should contain the full-length sequence (918 bp) encoding the 306 amino acid protein . When expressing in E. coli, it is important to consider codon optimization for improved expression efficiency, as fungal codon usage differs from bacterial systems. Alternative expression hosts include yeast systems (particularly Saccharomyces cerevisiae or Pichia pastoris) for situations where post-translational modifications might be important for proper folding or activity.

How stable is recombinant cbr1 under laboratory conditions?

Recombinant cbr1 stability depends on storage and handling conditions. The purified protein is typically stored as a lyophilized powder or in buffer containing glycerol as a cryoprotectant . For short-term storage (up to one week), the protein can be kept at 4°C in appropriate buffer conditions. For long-term storage, aliquoting and storing at -20°C or -80°C is recommended to prevent repeated freeze-thaw cycles that can compromise protein integrity and activity . The addition of 5-50% glycerol (final concentration) is recommended when preparing aliquots for freezing. When reconstituting lyophilized protein, a concentration of 0.1-1.0 mg/mL in deionized sterile water is typically suitable .

What are the standardized methods for assaying cbr1 enzymatic activity?

Two primary assays are commonly used to measure cbr1 activity:

  • NADH-cytochrome b5 reductase assay: This direct assay measures the rate of cytochrome b5 reduction by monitoring the increase in absorbance at 423 nm. The standard reaction mixture contains 1 × 10^-4 M NADH, 1 × 10^-5 M cytochrome b5, and the enzyme in 2 ml of 0.1 M potassium phosphate buffer (pH 7.5) . The reduction of cytochrome b5 is quantified using a molar extinction coefficient of 100 cm^-1 mM^-1 at 423 nm between reduced and oxidized cytochrome b5 .

  • NADH-ferricyanide reductase assay: This indirect assay measures activity by following the decrease in optical density at 420 nm as ferricyanide is reduced. The reaction mixture typically contains 3 × 10^-4 M NADH, 1 × 10^-3 M potassium ferricyanide, and the enzyme in a suitable buffer system .

These assays provide complementary information about the enzyme's electron transfer capabilities and can be used to characterize both wild-type and mutant forms of the protein.

How does pH affect the catalytic activity of cbr1?

The pH environment significantly influences cbr1 activity, with optimal activity typically observed in the pH range of 7.0-7.5. At low pH values (below 6.0), the activity is substantially inhibited, likely due to protonation of key amino acid residues involved in enzyme catalysis or substrate binding . This pH-dependence is particularly relevant in Aspergillus species, which often produce organic acids and can create acidic microenvironments during growth. The pH effect on cbr1 activity has implications for both in vitro enzymatic assays and in vivo metabolic engineering applications in A. niger, where controlling culture pH becomes crucial for maintaining optimal enzyme function .

What cofactors are required for optimal cbr1 activity?

For optimal activity, cbr1 requires the following cofactors:

  • NADH: Acts as the primary electron donor, with the enzyme showing strong specificity for NADH over NADPH . The binding of NADH involves specific interactions with the nucleotide-binding domain of the enzyme.

  • FAD: Functions as a prosthetic group essential for the enzyme's electron transfer capability. The FAD molecule is tightly but non-covalently bound to the enzyme.

Additionally, divalent metal ions may influence activity, although they are not absolute requirements. The enzyme typically maintains activity in the presence of EDTA, indicating that metal ions are not essential cofactors . For in vitro reconstitution experiments, it's important to ensure that both NADH and fully functional FAD-containing cbr1 are present in the reaction mixture.

How can cbr1 be utilized in engineering Aspergillus niger for enhanced organic acid production?

Engineering A. niger for improved organic acid production through cbr1 manipulation involves several strategic approaches:

  • Electron transfer optimization: Since cbr1 functions in electron transfer systems that support cytochrome P450 enzymes, modulating its expression can influence redox balance and metabolic flux through pathways involved in organic acid production .

  • Integration with CRISPR-Cas9 engineering: Using ribonucleoprotein (RNP)-based CRISPR-Cas9 systems, researchers can precisely modify cbr1 expression alongside other target genes involved in organic acid biosynthesis. In a study focusing on succinic acid production, this approach achieved significant yield improvements, with engineered strains producing up to 17 g/L succinic acid from synthetic substrates and 23 g/L from sugar beet molasses .

  • Coordination with transporters: For effective organic acid production, cbr1 engineering should be coordinated with the expression of appropriate transporters. For example, C4-dicarboxylate transporters can be overexpressed alongside metabolic modifications to enhance organic acid export .

The optimization process should consider cultivation parameters such as temperature (optimal around 35°C for succinic acid production) and pH (acidic conditions may inhibit production) .

What is the role of cbr1 in supporting cytochrome P450-mediated reactions in fungi?

Cbr1 plays a sophisticated role in supporting cytochrome P450-mediated reactions in fungi through several mechanisms:

  • Complete electron donation cycle: Unlike in mammalian systems where the cbr1/cytochrome b5 system primarily provides the second electron in P450 catalysis, fungal cbr1 can support both the first and second electron transfer steps required for complete P450 catalytic cycles . This was demonstrated in studies showing that the NADH/cytochrome b5/CBR system can wholly and efficiently support CYP51-mediated sterol 14α-demethylation in Candida albicans .

  • Metabolic redundancy: In some fungi, cbr1 functions in parallel with the cytochrome P450 reductase (CPR) system, providing metabolic redundancy that ensures continued function of essential P450-dependent pathways even when one electron transport system is compromised . This explains why CPR gene disruption is not always lethal in fungi that maintain a functional cytochrome b5/cbr1 system.

  • Substrate-specific electron transfer: For certain reactions, such as benzo[a]pyrene (BaP) metabolism, the electron transfer efficiency and product specificity differ depending on whether electrons are supplied via the CPR or cbr1/cytochrome b5 pathway . This substrate-specific electron transfer capability allows for fine-tuned regulation of P450-mediated reactions in different metabolic contexts.

How does temperature affect the stability and activity of recombinant cbr1?

Temperature influences both the stability and catalytic efficiency of recombinant cbr1 in complex ways:

  • Thermal stability profile: Recombinant cbr1 from A. niger typically maintains structural integrity up to approximately 40-45°C, beyond which protein unfolding begins to occur. The exact thermal denaturation profile depends on buffer conditions, with higher salt concentrations and the presence of stabilizing agents like glycerol improving thermal stability.

  • Temperature optima for activity: Enzymatic activity studies indicate that the optimal temperature for cbr1 activity in Aspergillus species is approximately 35°C . This corresponds to the temperature at which the highest yields of succinate were obtained in metabolic engineering studies (after 3 days of cultivation), suggesting that the temperature optimum for cbr1 aligns with broader metabolic processes in the organism .

  • Cold sensitivity: At temperatures below 20°C, activity decreases significantly, which correlates with observations in A. fumigatus where cytochrome b5 function is linked to low-temperature tolerance . This suggests that the electron transport system involving cbr1 may have temperature-dependent roles in cell physiology beyond its direct catalytic function.

For experimental design, maintaining temperature control is critical when measuring cbr1 activity, as even small fluctuations around the optimum can significantly impact reaction rates.

What are effective strategies for genetic manipulation of cbr1 in Aspergillus niger?

Several genetic manipulation strategies have proven effective for modifying cbr1 in A. niger:

  • RNP-based CRISPR-Cas9 system: This approach involves in vitro assembly of Cas9 protein and guide RNA (gRNA) to form ribonucleoprotein (RNP) complexes that are then transformed into protoplasts along with selection markers and/or donor DNA fragments . While showing lower efficiency (12.5-38% gene disruption) compared to plasmid-based systems, this method offers advantages in reducing off-target effects through precise control of Cas9 protein and gRNA concentrations .

  • Homologous recombination with selectable markers: Traditional gene replacement strategies using homologous recombination remain effective, particularly when combined with dominant selectable markers on AMA plasmids that facilitate the selection of transformants .

  • Expression optimization: For overexpression studies, strong constitutive promoters (e.g., gpdA) or inducible systems can be employed. The addition of affinity tags (His6) at the N-terminus facilitates purification without significantly impacting enzyme activity .

When designing genetic manipulation experiments, it's important to consider that alterations in cbr1 expression may have pleiotropic effects on various P450-dependent pathways, potentially affecting growth, morphology, and secondary metabolism .

What is known about the protein structure of cbr1 and its functional domains?

The protein structure of A. niger cbr1 consists of several functional domains with specific roles:

  • N-terminal FAD-binding domain: This region contains the characteristic Rossmann fold motif (GxGxxG) responsible for binding the FAD cofactor, which serves as the primary electron acceptor from NADH .

  • C-terminal NADH-binding domain: This region is responsible for NADH binding and contains residues that facilitate hydride transfer from NADH to FAD .

  • Transmembrane domains: Similar to cytochrome b5 reductases in other species, A. niger cbr1 likely contains a membrane-binding region. Studies in A. fumigatus revealed that the C-terminus of the related cytochrome b5 reductase contains two transmembrane domains that localize the protein to the endoplasmic reticulum . Deletion of these domains results in defective growth phenotypes similar to complete gene deletion .

  • Amino acid sequence: The full amino acid sequence of A. niger cbr1 contains 306 amino acids, as encoded by the 918 bp open reading frame . Key residues conserved across fungal species are involved in FAD and NADH binding, as well as in the electron transfer pathway.

How does A. niger cbr1 compare to homologous proteins in other fungal species?

A comparative analysis of A. niger cbr1 with homologous proteins reveals important evolutionary and functional relationships:

SpeciesProtein NameSequence Identity to A. niger cbr1Key Functional DifferencesReference
A. terreusNADH-cytochrome b5 reductase 1~85%Longer sequence (296 aa vs. 306 aa); differences in membrane-binding region
A. fumigatusCybE/CB5R~80%Essential for normal growth; localizes to endoplasmic reticulum; affects hyphal tip growth
C. albicansNADH cytochrome b5 reductase~60%Can fully support CYP51-mediated sterol 14α-demethylation
S. cerevisiaeCyb5 reductase~55%Non-essential; deletion shows no growth phenotype unless combined with CPR deletion

The most significant differences occur in the membrane-binding domains and in regulatory elements that control expression patterns. Functionally, while the catalytic mechanism of electron transfer is conserved, the physiological roles vary considerably between species, particularly in terms of essentiality for growth and development .

How does the cbr1/cytochrome b5 system interact with other electron transfer systems in fungal metabolism?

The cbr1/cytochrome b5 system interacts with other electron transfer systems in fungi through several sophisticated mechanisms:

  • Functional redundancy with CPR: In many fungi, the cbr1/cytochrome b5 system operates in parallel with the CPR system, providing redundancy for critical electron transfer reactions . This redundancy explains why fungi can continue producing ergosterol even when CPR is disrupted .

  • P450-specific interactions: Different P450 enzymes show varying dependencies on the cbr1/cytochrome b5 versus CPR systems. For example, in Cochliobolus lunatus, reconstitution experiments with benzoate 4-hydroxylase (CYP53A15) showed that both CPR1 and CPR2 can support activity, but with different product specificities .

  • Cross-talk during metabolic stress: During conditions of metabolic stress or when one electron transfer system is compromised, compensatory upregulation of alternative pathways occurs. For instance, deletion of cytochrome b5 in A. fumigatus leads to increased transcription of CPR-encoding genes, suggesting inter-system regulation .

  • Integration with mitochondrial function: The cbr1/cytochrome b5 system influences mitochondrial membrane potential, suggesting a role in coordinating cellular energy metabolism with electron transfer requirements for biosynthetic pathways .

This complex network of interactions allows fungi to maintain metabolic flexibility and adapt to changing environmental conditions or genetic perturbations affecting electron transfer systems.

What are the potential applications of cbr1 in metabolic engineering beyond organic acid production?

The unique electron transfer capabilities of cbr1 present several promising applications in metabolic engineering:

  • Bioremediation systems: Engineering A. niger to express specific P450 enzymes supported by enhanced cbr1 activity could create efficient bioremediation systems for environmental pollutants. The demonstrated ability of the cbr1/cytochrome b5 system to support benzo[a]pyrene metabolism suggests potential for degrading persistent organic pollutants .

  • Steroid and terpenoid biosynthesis: Since cbr1 can support sterol biosynthesis pathways, engineered strains with optimized cbr1 expression could enhance production of high-value steroids and terpenoids that require P450-mediated steps in their biosynthesis .

  • Heterologous protein expression: Understanding and manipulating cbr1's role in maintaining proper membrane composition and fluidity through its support of ergosterol biosynthesis could lead to improved heterologous protein expression systems in Aspergillus species, particularly for membrane-associated proteins .

  • Antifungal resistance studies: Since the cbr1/cytochrome b5 system can support essential P450 enzymes targeted by azole antifungals, studying this pathway could provide insights into novel antifungal strategies or mechanisms of resistance .

These applications would require sophisticated genetic engineering approaches, potentially combining cbr1 modifications with other metabolic pathway adaptations to achieve the desired phenotypes.

What methodological advances are needed to better understand cbr1 function in vivo?

Several methodological advances would significantly enhance our understanding of cbr1 function in vivo:

  • Real-time electron transfer imaging: Development of fluorescent or luminescent probes that can monitor electron flow through the cbr1/cytochrome b5 system in living cells would provide unprecedented insights into the spatial and temporal dynamics of these reactions.

  • Conditional expression systems: More sophisticated inducible expression systems specifically tailored for A. niger would allow for temporal control of cbr1 expression, facilitating studies on its immediate versus long-term effects on metabolism.

  • Improved CRISPR-Cas9 delivery: Enhancing the efficiency of RNP complex delivery to protoplasts could increase the current 12.5-38% gene disruption efficiency, making genetic studies more streamlined .

  • Metabolic flux analysis tools: Development of more sensitive methods for quantifying the flow of electrons through different pathways would help distinguish the relative contributions of cbr1 versus CPR systems to specific P450-mediated reactions under different physiological conditions.

  • In vivo protein-protein interaction assays: Adapting techniques like bimolecular fluorescence complementation (BiFC) or proximity labeling for use in filamentous fungi would help elucidate the dynamic interactions between cbr1, cytochrome b5, and various P450 enzymes in their native cellular context.

These methodological advances would collectively enable a more comprehensive understanding of how cbr1 functions within the complex metabolic network of A. niger and other filamentous fungi.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.