Recombinant Aspergillus niger Patatin-like phospholipase domain-containing protein An01g04180 (An01g04180)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
An01g04180; Patatin-like phospholipase domain-containing protein An01g04180
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-749
Protein Length
full length protein
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Target Names
An01g04180
Target Protein Sequence
MNGAEKSAAGDTYDPSTIPDYDREFIHPDDLRQFELALTDQGASPLVALNDWRPIYQRVR RERGRRKEPRRTKDETREGVLYTVLKWPFLFTVFGWITALAFAYTLTRVYIFLYEQWVTW RGRRQSLRRQLHAQTNYPDWQKAARALDDHLGNQRWKEIDEYAYYDHLTISNLVKQLKKV RREVERERREKRRGSGQSPAAEELCTLLEACVKNNFAGVENPRLYSEAYSGTKNLVQEYI DELHACIQLVADSKGITSEEKLQHFKHLDTNFGRTALCLSGGATFAYYHFGVVRALLDNG VLPEIITGTSGGALVAALVATRTDEELKQLLVPALAHRIRACQESFPTWVWRWWRTGARF DTLDWARQCSWFCRGSTTFREAYERTGRILNVSCVPSDPHSPTILANYLTSPNCVIWSAV LASAAVPGILNPVVLMTKKRDGTLAPYSFGHKWKDGSLRTDIPIKALNLHFNVNFTIVSQ VNPHINLFFFSSRGTVGRPVTHRKGRGWRGGFLGSAIEQYIKLDMNKWLRVLRHLELLPR PMGQDWSEIWLQKFSGTVTIWPKTIPSDFYHILSDPNPERLARMLRVGQQSAFPKLQFIK NRLKIEIAVVKSLQKFAHAGGRPISPAPSRWRQNNDPDNHYNPSPRTDPLNERLDHNLPE RRGDNVNITFGEGGGREDTHLLDGSLSENSSNESAARPSSSSSSSRLLRVPEHRRGSTGS SIFEEVRRQSAVFFDDVDMYGDDEALRPG
Uniprot No.

Target Background

Function

Probable lipid hydrolase.

Database Links
Protein Families
PLPL family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structural composition of An01g04180?

An01g04180 is a full-length protein (749 amino acids) containing a patatin-like phospholipase domain from Aspergillus niger. The primary structure includes several conserved regions characteristic of patatin-like phospholipases, particularly the catalytic dyad necessary for lipid hydrolysis. The protein contains a predicted signal peptide or transmembrane domain that suggests targeting to the secretory pathway, similar to other patatin-like phospholipases studied in different organisms . The complete amino acid sequence begins with MNGAEKSAAGDTYDPSTIPDYDREFIHPDDLRQFELALTDQGASPLVALNDWRPIYQRVR and continues for the full 749 residues . The molecular weight of the native protein is approximately 168 kDa as determined by SDS-PAGE analysis, which is consistent with other fungal hydrolases characterized from Aspergillus species . This protein belongs to a broader family of enzymes that typically function in membrane modification or disruption processes, with multiple conserved domains supporting its classification as a phospholipase.

How does the patatin-like domain functionally differentiate An01g04180 from other phospholipases?

The patatin-like domain in An01g04180 distinguishes it from classical phospholipases through its unique catalytic mechanism and substrate specificity. Unlike conventional phospholipases that utilize a catalytic triad, patatin-like domains employ a catalytic dyad consisting of a serine and an aspartate residue for hydrolysis reactions . This configuration creates distinct substrate-binding pockets that influence enzyme specificity. The patatin domain in An01g04180 shares homology with other patatin-like phospholipase domain-containing proteins (PNPLAs) that have been implicated in membrane disruption processes, particularly during developmental transitions in fungi . The domain structure facilitates interaction with phospholipid substrates through a hydrophobic surface that allows temporary membrane association during catalysis. Research on related PNPLAs in Plasmodium falciparum demonstrates these enzymes' importance in cellular processes such as egress from host cells, suggesting analogous functions may exist for An01g04180 in Aspergillus niger's developmental cycles . The domain's evolutionary conservation across diverse organisms underscores its fundamental importance in lipid metabolism and membrane remodeling.

What are the optimal conditions for recombinant expression of An01g04180?

The recombinant expression of An01g04180 has been successfully achieved in E. coli systems using optimized protocols that address the challenges of fungal protein expression in bacterial hosts . For optimal expression, the full-length protein sequence (1-749 amino acids) is typically cloned into an expression vector incorporating an N-terminal His-tag to facilitate subsequent purification . Expression in E. coli requires careful optimization of induction parameters including IPTG concentration (typically 0.5-1.0 mM), induction temperature (reduced to 16-20°C), and extended induction periods (16-20 hours) to maximize soluble protein yield. This approach differs from native Aspergillus niger protein expression, where fungi can be cultivated on various carbon sources to induce protein production. Comparative studies on other Aspergillus niger enzymes have shown that expression using the TAKA amylase promoter from Aspergillus oryzae can yield high productivity levels in fungal hosts, accounting for approximately 1% of total cellular protein under optimized conditions . For researchers seeking alternative expression systems, Aspergillus niger itself can be used as a host, particularly strains engineered for heterologous protein expression, with carbon-limited chemostat cultivations providing consistent protein yields . The choice between bacterial and fungal expression systems depends on research requirements for protein folding, post-translational modifications, and scale of production.

How can researchers optimize purification protocols for recombinant An01g04180?

Purification of recombinant His-tagged An01g04180 requires a systematic approach beginning with optimized cell lysis and proceeding through multiple chromatography steps. The initial cell lysis should be performed using a buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10 mM imidazole, and protease inhibitors, with sonication or high-pressure homogenization to ensure complete disruption of bacterial cells . For purification, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin serves as an effective first step, with protein elution achieved through an imidazole gradient (50-250 mM). Following IMAC, ion exchange chromatography can be employed as demonstrated in similar fungal enzyme purifications, using gradient cation-exchange chromatography with a TOYOPEARL Sulfate column and buffer systems of 50 mM NaOAc (pH 4.0) with increasing NaCl concentration (0-1.5 M) over 70 minutes at 1 mL/min flow rate . Final purification can be achieved through size exclusion chromatography to remove aggregates and ensure homogeneity. For fungally-expressed protein, ammonium sulfate fractionation followed by DEAE-Sephadex A-50 chromatography has proven effective for similar Aspergillus niger enzymes . Throughout the purification process, enzyme activity should be monitored using appropriate phospholipase assays to track recovery of active protein. The purified protein can be lyophilized and stored in Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability, with storage at -20°C/-80°C and avoidance of repeated freeze-thaw cycles .

What assays are most effective for measuring the enzymatic activity of An01g04180?

Enzymatic activity of An01g04180 can be effectively measured using multiple complementary approaches that assess its phospholipase function. The primary assay involves spectrophotometric monitoring of phospholipid hydrolysis using synthetic substrates such as p-nitrophenyl palmitate (pNPP) or 4-methylumbelliferyl palmitate, which release chromogenic or fluorogenic products upon hydrolysis. This assay should be performed in buffer conditions starting at pH 6.0 (the pH optimum for many Aspergillus niger enzymes) at temperatures between 30-40°C . For kinetic analysis, researchers should determine Km and Vmax values by varying substrate concentrations from 0.1 mM to 10 mM, with detailed analysis between 0.01-1.0 mM where maximal activity is commonly observed for fungal hydrolases . Additionally, thin-layer chromatography (TLC) can be employed to analyze the hydrolysis of natural phospholipid substrates, providing insights into substrate specificity. Researchers should also consider conducting phospholipase activity assays in the presence of various metal ions (Zn²⁺, Mn²⁺, Cu²⁺, Ca²⁺, Mg²⁺, and Fe²⁺) to assess their inhibitory or activating effects, as demonstrated with similar enzymes from Aspergillus niger . For advanced functional characterization, researchers can utilize liposome-based assays where fluorescently-labeled phospholipids are incorporated into artificial membranes, allowing real-time monitoring of membrane disruption activities that may be relevant to the protein's biological function. These multiple approaches provide complementary data about catalytic efficiency, substrate preference, and physiological function.

How can researchers investigate the structure-function relationship of An01g04180?

Investigating the structure-function relationship of An01g04180 requires an integrated approach combining computational prediction, site-directed mutagenesis, and functional analysis. Researchers should begin with computational structural modeling based on homologous patatin-like phospholipases with solved crystal structures, using tools such as Swiss-Model, Phyre2, or AlphaFold. These models can identify putative catalytic residues, substrate-binding regions, and structural motifs. Site-directed mutagenesis experiments should then target predicted catalytic residues (particularly the serine-aspartate dyad characteristic of patatin domains) and substrate-binding regions to create variants for functional testing. Each variant should undergo complete kinetic characterization using the assays described above to quantify changes in catalytic parameters. For more detailed structural insights, researchers can employ limited proteolysis combined with mass spectrometry to identify stable domains and flexible regions. Circular dichroism spectroscopy provides additional information about secondary structure elements and their stability under varying conditions of pH and temperature. Advanced researchers should consider hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify regions undergoing conformational changes upon substrate binding. For definitive structural analysis, X-ray crystallography or cryo-electron microscopy should be pursued, with protein samples prepared at concentrations of 5-10 mg/mL in buffers optimized for crystallization trials. These approaches collectively provide comprehensive insights into how specific structural elements contribute to substrate recognition, catalysis, and regulatory mechanisms.

How is the expression of An01g04180 regulated in Aspergillus niger?

The expression of An01g04180 in Aspergillus niger is regulated through complex mechanisms responding to environmental and metabolic cues. Studies on similar Aspergillus niger genes indicate that carbon source availability strongly influences expression patterns, with glucose and maltose exerting different regulatory effects . In batch cultivations of recombinant Aspergillus strains, the highest product yield coefficients were obtained during growth on glucose for some strains (5.7±0.65 KU/g DW) and on maltose for others (6.3±0.02 KU/g DW), suggesting carbon source-dependent regulation . For An01g04180, researchers should investigate expression using both transcriptomic and proteomic approaches across different growth conditions. RNA sequencing analysis during different developmental stages and nutrient conditions can reveal transcriptional regulation patterns, while promoter analysis can identify potential transcription factor binding sites regulating expression. Based on studies of other phospholipases, researchers should examine if An01g04180 expression changes during stress conditions, particularly oxygen limitation, as Aspergillus niger metabolism shifts significantly under these conditions . The integration of a heterologous gene expression system such as the Tet-on system used for studying AnAFP in Aspergillus niger provides a powerful tool for investigating gene function through controlled expression . This approach allows researchers to induce An01g04180 expression at specific timepoints and observe subsequent phenotypic effects, including potential impacts on growth, development, or stress responses.

What is the potential cellular localization and function of An01g04180 in Aspergillus niger?

The cellular localization and function of An01g04180 can be determined through integrated experimental approaches. Based on sequence analysis, An01g04180 contains predicted signal peptide or transmembrane domains, suggesting targeting to the secretory pathway and potential involvement in membrane modification or disruption processes . To experimentally confirm localization, researchers should develop fluorescent fusion proteins (e.g., An01g04180-GFP) and employ confocal microscopy to visualize subcellular distribution in living Aspergillus cells. Studies on related patatin-like phospholipases in Plasmodium falciparum localized similar proteins to the plasma membrane (PPM) in both asexual and sexual blood stages, providing a starting hypothesis for An01g04180 localization . Functional analysis through gene disruption (knockout) experiments can reveal phenotypic consequences, though patatin-like phospholipases often show redundancy as demonstrated in Plasmodium studies where several were found dispensable for gametocyte development . For more detailed functional analysis, researchers should utilize the CRISPR-Cas9 system to generate precise knockouts or conditional expression strains, allowing temporal control of gene expression using systems such as the Tet-on inducible system . Phenotypic analysis should include growth measurements under various conditions, microscopic examination of hyphal morphology, and assessment of membrane integrity using fluorescent dyes. Biochemical fractionation followed by Western blotting with specific antibodies provides complementary evidence for protein localization. Based on studies of other fungal phospholipases, potential functions may include roles in membrane remodeling during growth, development, or stress responses, particularly involving lipid metabolism and hyphal morphogenesis.

What methodological approaches are best for studying potential protein-protein interactions of An01g04180?

Investigating protein-protein interactions (PPIs) of An01g04180 requires a multi-method approach to identify and validate potential binding partners. Researchers should begin with affinity purification coupled with mass spectrometry (AP-MS), using tagged An01g04180 as bait to isolate interaction complexes from Aspergillus niger lysates under native conditions. This approach should be performed under different growth conditions to capture condition-specific interactions. For validation of identified interactions, bimolecular fluorescence complementation (BiFC) can be employed, where potential interacting proteins are fused to complementary fragments of a fluorescent protein that reconstitute fluorescence when brought together by interaction. Yeast two-hybrid screening provides a complementary approach for detecting binary interactions, though careful consideration of membrane-associated proteins is necessary when designing constructs. Surface plasmon resonance (SPR) offers quantitative analysis of binding kinetics and should be performed using purified recombinant proteins, similar to methods employed for studying integrin alpha 4 beta 1 protein interactions . SPR experiments should include concentration series (typically 0.1-100 nM) of potential binding partners flowing over immobilized An01g04180, with analysis of association and dissociation rates. For structural characterization of complexes, researchers can employ techniques such as chemical cross-linking coupled with mass spectrometry (XL-MS) to identify interacting interfaces. Functional validation of identified interactions should include co-localization studies in living cells using differentially labeled proteins (e.g., An01g04180-GFP and partner-RFP) and co-immunoprecipitation from cellular lysates using specific antibodies. These comprehensive approaches provide a detailed interaction network that informs the cellular functions of An01g04180.

What are the common challenges in expressing and purifying active An01g04180, and how can they be addressed?

Researchers face several challenges when expressing and purifying active An01g04180, each requiring specific troubleshooting strategies. Protein solubility is a primary concern, as fungal proteins expressed in bacterial systems often form inclusion bodies. To address this, researchers should optimize expression conditions by reducing induction temperature to 16-20°C, decreasing IPTG concentration to 0.1-0.3 mM, and co-expressing molecular chaperones such as GroEL/GroES or trigger factor. Adding solubility-enhancing fusion tags like MBP (maltose-binding protein) or SUMO in addition to the His-tag can significantly improve soluble protein yields. For proteins that remain insoluble, researchers should develop refolding protocols using gradual dialysis against decreasing concentrations of chaotropic agents (6M to 0M urea) in the presence of redox pairs (reduced/oxidized glutathione) to promote correct disulfide bond formation. Protein instability during purification can be addressed by including stabilizing agents such as glycerol (10-20%) and reducing agents like DTT (1-5 mM) in all buffers. Enzyme activity loss is another common challenge; researchers should minimize the number of purification steps and conduct activity assays after each step to monitor recovery. For proteins expressed in fungal systems, secretion and cell wall association can complicate purification, as demonstrated in Aspergillus niger strains where heterologous enzymes were found bound to the cell wall . This issue can be addressed by including cell wall-degrading enzymes like glucanases in extraction buffers or using high-salt washes (0.5-1.0 M NaCl) to release wall-associated proteins. Proteolytic degradation can be minimized by including a comprehensive protease inhibitor cocktail and conducting all purification steps at 4°C with minimal sample handling time.

How can researchers overcome difficulties in determining substrate specificity of An01g04180?

Determining the substrate specificity of An01g04180 presents methodological challenges requiring systematic approaches. The primary difficulty lies in assessing activity across diverse phospholipid substrates that vary in head group composition and fatty acid chain length/saturation. Researchers should develop a comprehensive substrate panel including phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, phosphatidylinositol, and phosphatidylglycerol with varying fatty acid compositions. For each substrate, parallel assay methods should be employed, including: (1) radiometric assays using ³²P-labeled phospholipids with thin-layer chromatography separation of products; (2) fluorometric assays with FRET-based phospholipid substrates that change emission properties upon hydrolysis; and (3) mass spectrometry-based approaches to directly identify reaction products. When activity is low or undetectable, researchers should systematically vary reaction conditions, testing pH ranges from 4.0-9.0 and temperatures from 25-50°C, as optimal conditions for fungal enzymes often differ significantly from standard assay conditions . The addition of potential cofactors such as Ca²⁺ (0.5-5 mM) may be critical for enzyme activation. For membrane-associated substrates, the presentation format significantly impacts activity; therefore, substrates should be tested in multiple forms including mixed micelles with detergents (0.1-0.5% Triton X-100), incorporated into liposomes of varying composition, and as monolayers at defined surface pressures. Substrate competition assays provide valuable information on binding preferences, where unlabeled substrates compete with labeled reporter substrates. For advanced analysis, researchers should employ computational docking studies using structural models to predict substrate binding modes, followed by site-directed mutagenesis of predicted binding pocket residues to confirm their role in substrate recognition.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.