Recombinant Aspergillus niger Plasma membrane fusion protein prm1 (prm1)

Shipped with Ice Packs
In Stock

Description

Overview of PRM1 Proteins

PRM1 (Plasma Membrane Fusion Protein 1) is a conserved fungal protein critical for membrane fusion during cellular processes like mating and hyphal fusion. While PRM1 is well-studied in Saccharomyces cerevisiae and Vanderwaltozyma polyspora , no direct evidence exists for its characterization in Aspergillus niger in the provided sources.

Key Features of PRM1 Homologs

  • Structural Attributes:

    • Full-length PRM1 from V. polyspora spans 659 amino acids with a predicted molecular weight of ~75 kDa .

    • Contains transmembrane domains and a His-tag for purification in recombinant systems .

  • Functional Role: Facilitates plasma membrane fusion during mating and cellular differentiation .

Recombinant Protein Production in Aspergillus niger

Aspergillus niger is a widely used host for recombinant protein production due to its high secretion capacity and GRAS (Generally Recognized As Safe) status. Key insights from its recombinant systems include:

Expression Systems

ComponentDetails
PromoterConstitutive promoters (e.g., gpd) or inducible systems (e.g., glaA) .
Secretion SignalGlucoamylase (GLA) prepro-sequence enhances secretion efficiency .
StrainsProtease-deficient strains (e.g., A. niger D15#26) minimize protein degradation .

Case Study: Recombinant Peroxidases

  • Manganese Peroxidase (MnP): Secreted at 100 mg/L in A. niger using glaA promoters, with correct N-terminal processing .

  • Challenges: Incorrect processing observed in lignin peroxidase (LiP), highlighting strain-specific limitations .

Comparative Analysis of Membrane-Associated Proteins in Aspergillus niger

While PRM1 is undocumented in A. niger, other membrane proteins play critical roles:

RmsA Protein

  • Function: Central to actin polarization, metabolism, and stress response .

  • Homology: Functional analog of S. cerevisiae Avo1p/Sin1, a TORC2 component .

  • Phenotypic Impact:

    • Deletion is lethal; temperature-sensitive mutants show hyphal depolarization and reduced viability .

Secretory Pathway Components

ProteinRoleReference
CalnexinGlycoprotein folding in the ER
Glucoamylase (GlaA)Major secreted enzyme; used as a tag
β-GlucanotransferasesCell wall remodeling

Hypothetical Framework for PRM1 in Aspergillus niger

If PRM1 exists in A. niger, its recombinant production would likely follow established protocols:

Expression Strategy

  1. Vector Design:

    • Use gpd promoter and glaA terminator for constitutive expression .

    • Fuse with His/GST tags for purification .

  2. Host Strain: Protease-deficient A. niger D15#26 to enhance stability .

  3. Cultivation: Optimize carbon sources (e.g., lactose or whey) for high yield .

Expected Challenges

  • Post-Translational Modifications: Potential glycosylation differences compared to yeast homologs .

  • Secretion Efficiency: Dependent on signal peptide compatibility .

Research Gaps and Future Directions

  • Genomic Evidence: A. niger CBS 513.88’s genome contains 14,165 ORFs , but PRM1 homologs are not annotated.

  • Functional Studies: Targeted knockouts or heterologous expression of V. polyspora PRM1 in A. niger could elucidate cross-species functionality.

Table 1: Recombinant Protein Production in A. niger

ProteinYieldTagActivityReference
Mn Peroxidase (MnP)100 mg/LNone54 U/mL (pH 4.5)
Endoglucanase (Eg2)54 U/mLNonepH optimum 4.8
V. polyspora PRM1>90% purityHis-tagNot assayed

Table 2: Key A. niger Strains for Recombinant Expression

StrainGenotypeApplicationReference
D15#26cspA1, pyrG1, prtT13, phmAProtease-deficient host
CBS 513.88Wildtype (enzyme production)Genome reference
H915-1High citrate producerMetabolic studies

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributors.
All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own formulations.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
prm1; An04g05460; Plasma membrane fusion protein prm1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-739
Protein Length
full length protein
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Target Names
prm1
Target Protein Sequence
MLFSKSGRTIFPLLPPYGVQDPNGVQGRVIPVHPDGSTPYLGLRARLSQVWLNRWTVLLL LVLARVLMAASSIKTDMNRAKSEALSACTSVESMGDAMVSMPHYLAEGVNELTADGVNAA IDGLKMLLMLTLTGVEELVIFFVKVMYQTYLCLFTLVVHGVVDVGLSLIEDVTDVLNSTV KTVAKDIAKVTETFEDDYNTLISKINGVASLFGGSVPTLNISSEIDKLENVQLSSSIDKD LQKINDSIPNFNEVMNFTENVIRFPFDEVKKLVNESLGNYTFNASALPVPAKKTLTFCDK NDGINSFFAGATDIILTARKIFIAILVVAAIIACVPMAWQEIRRWHTMKERSQLVRKEAH DPMDVVYIVSRPHTAAIGIKAASRFSNSRRQILVRWVIAYATSPAALFVLLLALAGLLSC LCQFILLSAVKRTVPELSNEVGDFAEEVVDVLQNTSAQWANDANKVIQNVDDELNDHVFG WVNTSTGALNDTLNTFVNKTIGVLNDTFGGTLLYEPLLDVFDCLVGLKVESVQKGLTWVS DHAHIDFPLLPNDTFSRGAEGSLNSSDASESFLADAGDETSNKITEVVYKVISALEKALL IEVIIASCILLVWVINAMFGIIRALTLFWGRDKNRGEGGPAPPNSRPNPGSGPDSHGFID VPLTSLPSHRDADETAARSQPAPRYEVATSQGSSAAVVSSELEYPDEKVGFAGQRNALRV DGVSDLRGSSYVEYGIEKY
Uniprot No.

Target Background

Function
The protein plays a crucial role in cell fusion during mating by stabilizing the plasma membrane fusion event.
Database Links
Protein Families
PRM1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Plasma membrane fusion protein prm1 in Aspergillus niger?

Plasma membrane fusion protein prm1 in Aspergillus niger is a multipass membrane protein that likely promotes plasma membrane fusion during cellular development. Similar to its homolog in yeast, it plays a critical role in fusion events at the cellular level. The protein contains specific domains that facilitate membrane interactions and homotypic recognition, which are essential for proper fusion activity. In yeast, Prm1p has been demonstrated to form covalently linked homodimers via intermolecular disulfide bonds between specific cysteine residues, which is crucial for its function . This dimerization mechanism may also be conserved in the Aspergillus niger prm1 protein, though specific studies on the A. niger variant are still developing.

What are the structural characteristics of recombinant Aspergillus niger prm1?

Recombinant Aspergillus niger prm1 likely shares key structural features with its yeast counterpart, which includes multiple transmembrane domains that anchor it within the plasma membrane. Based on studies of yeast Prm1p, the A. niger variant likely contains critical cysteine residues that form intermolecular disulfide bonds essential for dimerization and function . The protein would be expected to have a signal peptide for proper cellular targeting and potentially contains domains rich in serine and threonine residues that serve as sites for O-glycosylation, similar to other fungal cell surface proteins . These structural features collectively contribute to the protein's role in membrane fusion events. While the partial recombinant version available commercially may not contain all these domains, it would represent key epitopes or functional regions of the native protein .

What expression systems are most effective for producing recombinant A. niger prm1?

For recombinant expression of Aspergillus niger prm1, researchers have several options, each with distinct advantages depending on the experimental goals. E. coli expression systems offer high yield and simplicity but may struggle with proper folding of this multipass membrane protein. Similar fungal proteins have been successfully expressed in E. coli when focusing on specific domains rather than the full-length protein . Yeast expression systems (particularly S. cerevisiae or Pichia pastoris) provide a eukaryotic environment that better supports correct protein folding and post-translational modifications. For full functionality studies, homologous expression in Aspergillus itself may be preferable despite lower yields. When designing expression constructs, consideration should be given to codon optimization, inclusion of appropriate tags for purification, and whether glycosylation is required for the intended applications.

How can researchers effectively purify recombinant A. niger prm1 while maintaining its native structure?

Purification of recombinant A. niger prm1 requires specialized approaches due to its multipass membrane nature. A multi-step purification protocol would typically involve:

  • Membrane fraction isolation: Begin with differential centrifugation to isolate membrane fractions containing the recombinant protein.

  • Detergent solubilization: Carefully select detergents that effectively solubilize the protein while preserving its structure. Non-ionic detergents like DDM or Triton X-100 at concentrations just above their critical micelle concentration often provide a good starting point.

  • Affinity chromatography: Utilize fusion tags (His, GST, or FLAG) incorporated into the recombinant construct for initial purification. For proteins like prm1 that form disulfide bonds, avoid reducing agents during purification that might disrupt these linkages .

  • Size exclusion chromatography: Remove aggregates and isolate properly folded dimeric forms.

  • Validation: Confirm protein structure through techniques such as circular dichroism, limited proteolysis, or functional assays.

When working with fragments rather than the full protein, as is common with commercially available recombinant versions, simplification of this protocol may be possible while still maintaining structural integrity of the targeted domain .

What experimental approaches can determine if A. niger prm1 forms covalent dimers similar to its yeast homolog?

To investigate whether A. niger prm1 forms covalent dimers through disulfide bonds similar to yeast Prm1p, researchers should employ a multi-faceted approach:

  • Non-reducing vs. reducing SDS-PAGE: Compare protein mobility under reducing and non-reducing conditions. The presence of higher molecular weight bands under non-reducing conditions that resolve to monomeric size with reducing agents would suggest disulfide-linked dimers .

  • Site-directed mutagenesis: Based on sequence alignment with yeast Prm1p, identify conserved cysteine residues (potentially comparable to Cys-120 and Cys-545 in yeast) and create mutant constructs (C→S substitutions). Co-expression of wild-type and mutant versions would test if intermolecular disulfide formation occurs between specific residues .

  • Mass spectrometry: Analyze tryptic digests of purified protein complexes to identify disulfide-linked peptides.

  • Functional assays: Compare fusion activity of wild-type and cysteine mutants using membrane fusion assays or phenotypic rescue experiments.

This combined approach would provide robust evidence for or against conservation of the covalent dimerization mechanism between yeast and A. niger prm1 proteins.

How can researchers investigate the localization and trafficking of prm1 in Aspergillus niger hyphae?

Investigating the localization and trafficking of prm1 in A. niger hyphae requires specialized approaches for filamentous fungi:

  • Fluorescent protein fusions: Generate C- or N-terminal GFP/mCherry fusions of prm1, ensuring the fusion doesn't disrupt targeting signals or protein function. For membrane proteins like prm1, sandwich fusions (where the fluorescent protein is inserted into a permissive loop) may better preserve functionality.

  • Time-lapse microscopy: Track protein movement during hyphal growth and development using confocal microscopy with environmental chambers that maintain optimal conditions for A. niger.

  • Colocalization studies: Combine prm1 labeling with markers for specific organelles or membrane domains (e.g., ER, Golgi, plasma membrane) to trace the trafficking pathway.

  • Immunogold electron microscopy: For precise subcellular localization, use antibodies against prm1 with gold-conjugated secondary antibodies and transmission electron microscopy, similar to techniques used for other fungal cell wall proteins .

  • Inhibitor studies: Apply compounds that disrupt specific trafficking pathways (e.g., Brefeldin A for Golgi transport) to identify the routes of prm1 movement.

This approach would provide insights into both the steady-state localization and dynamic trafficking of prm1 within the complex hyphal structure of A. niger.

How does the amino acid sequence of A. niger prm1 compare to homologs in other fungi?

The amino acid sequence of A. niger prm1 shares several key features with homologs in other fungal species, though with notable species-specific variations:

FeatureA. niger prm1S. cerevisiae Prm1pA. fumigatus proteinsSignificance
Transmembrane domainsMultiple predictedMultiple confirmedMultiple in similar proteinsEssential for membrane anchoring
Key cysteine residuesPresent (positions may vary)Cys-120, Cys-545Present in cell wall proteinsCritical for disulfide bond formation
Hydrophobic domainsPresent adjacent to key cysteinesPresent adjacent to Cys-120Present in membrane proteinsMay mediate membrane interactions
Signal peptidePresentPresentPresent in cell wall/membrane proteinsNecessary for proper trafficking
Ser/Thr-rich regionsPresentPresentPresent in manno-proteinsSites for O-glycosylation

Sequence alignment analysis would likely show conservation of functional domains essential for membrane fusion activity, with higher variation in species-specific regions that may reflect adaptation to different cellular environments or developmental contexts. The conservation pattern of cysteine residues would be particularly informative regarding the potential for similar dimerization mechanisms across species .

What functional assays can determine if A. niger prm1 is actively involved in membrane fusion?

To determine if A. niger prm1 actively participates in membrane fusion, researchers can employ several functional assays:

  • Gene knockout/knockdown studies: Generate prm1 deletion mutants in A. niger and assess phenotypes related to hyphal fusion, development, or stress response. Complementation with the wild-type gene would confirm specificity of observed defects.

  • Heterologous expression: Express A. niger prm1 in prm1Δ yeast strains and assess rescue of mating-associated membrane fusion defects, which would indicate functional conservation .

  • Lipid mixing assays: Develop in vitro systems using purified recombinant prm1 and fluorescently labeled liposomes to directly measure membrane fusion events.

  • Split-GFP complementation: Engineer constructs where prm1 is fused to one half of a split GFP, with the complementary half targeted to potential interaction partners or opposite membranes. Fluorescence would indicate successful juxtaposition or fusion of membrane compartments.

  • Electron microscopy of fusion interfaces: Examine ultrastructural details of hyphal fusion zones in wild-type versus prm1 mutant strains to identify specific membrane abnormalities.

These assays collectively would provide strong evidence regarding the direct involvement of A. niger prm1 in membrane fusion processes.

How might the function of prm1 relate to Aspergillus niger pathogenicity?

The relationship between prm1 function and A. niger pathogenicity represents an important research question with potential clinical implications:

  • Tissue invasion mechanisms: If prm1 mediates hyphal fusion events, it may contribute to the formation of complex mycelial networks that enhance tissue invasion and colonization during infection .

  • Stress response adaptation: Membrane fusion proteins often play roles in membrane remodeling during stress. A. niger encounters significant stress during host invasion, and prm1 may contribute to adaptive responses.

  • Immune evasion: Changes in cell surface architecture mediated by membrane fusion events could potentially alter pathogen recognition by host immune systems.

  • Comparative analysis: Studies comparing prm1 sequence and expression between clinical and environmental isolates of A. niger could reveal adaptations associated with increased virulence.

  • Host-pathogen interaction models: In vitro co-culture systems with human cell lines could assess whether prm1 mutants show altered interactions with host cells compared to wild-type strains.

While direct evidence linking prm1 to pathogenicity remains limited, understanding its role in cellular development and membrane dynamics could provide insights into fungal adaptation during infection processes .

How can structural information about prm1 inform the development of antifungal strategies?

Structural insights into A. niger prm1 could significantly contribute to novel antifungal approaches:

  • Target identification: If prm1 forms covalent dimers essential for function (as in yeast), compounds that prevent dimer formation could specifically disrupt fungal development without affecting human cells .

  • Rational drug design: Detailed structural mapping of functionally critical domains could allow for the design of small molecules that bind specifically to these regions and inhibit activity.

  • Epitope mapping: Identification of surface-exposed, conserved epitopes could inform vaccine development or therapeutic antibody approaches, similar to strategies targeting other fungal cell surface proteins .

  • Species-specific targeting: Comparative structural analysis between A. niger prm1 and homologs in other pathogenic fungi could reveal regions of divergence that allow for species-targeted interventions.

  • Combination therapy approaches: Understanding how prm1 functions in membrane dynamics could reveal synergies with existing antifungals that disrupt membrane integrity, potentially enhancing their efficacy at lower doses.

The unique position of prm1 at the interface of cellular development and potential pathogenicity makes it a promising target for future antifungal research strategies.

What are the challenges in studying A. niger prm1 function in heterologous systems?

Researchers face several significant challenges when studying A. niger prm1 in heterologous systems:

  • Membrane protein expression barriers: As a multipass membrane protein, prm1 presents intrinsic challenges for expression in heterologous systems. Misfolding, aggregation, and toxicity to host cells are common issues that require optimization of expression conditions.

  • Post-translational modification differences: If A. niger prm1 requires specific glycosylation patterns for function, expression in bacteria or even other fungi may not recapitulate these modifications correctly.

  • Interacting partner availability: Prm1 likely functions within a network of proteins that facilitate membrane fusion. Heterologous systems may lack appropriate interaction partners, leading to incomplete functional characterization.

  • Cellular context differences: The architectural differences between unicellular yeast and filamentous A. niger mean that even successful protein expression may not reflect native functionality due to differences in cellular organization .

  • Assay development complexities: Developing appropriate functional assays in heterologous systems requires careful consideration of what aspects of prm1 function are being tested and whether the host system can support these activities.

Addressing these challenges requires careful experimental design, potentially combining heterologous expression for structural studies with homologous approaches for functional characterization.

How can transcriptomic and proteomic approaches enhance our understanding of prm1 regulation in A. niger?

Integrating transcriptomic and proteomic approaches offers powerful insights into prm1 regulation:

  • Expression profiling: RNA-seq analysis across different developmental stages and stress conditions can identify when prm1 is most actively transcribed, providing clues to its biological roles. Recent data mining from 283 microarray experiments in A. niger revealed that many genes are transcriptionally silent under standard laboratory conditions but expressed under specific circumstances .

  • Transcription factor identification: ChIP-seq approaches can identify transcription factors that bind to the prm1 promoter region, elucidating its regulatory network.

  • Post-translational modification mapping: Mass spectrometry-based proteomic approaches can identify specific modifications (phosphorylation, glycosylation, etc.) that may regulate prm1 activity and how these change under different conditions.

  • Protein interaction networks: Proximity labeling approaches (BioID, APEX) can identify proteins that interact with prm1 in living cells, revealing its functional associates.

  • Comparative analysis across strains: Proteomic comparison between wild-type and genetically modified strains (e.g., epigenetic regulator mutants) could reveal regulatory mechanisms controlling prm1 expression, similar to approaches used for studying biosynthetic gene clusters in A. niger .

These approaches collectively would provide a comprehensive view of how prm1 is regulated at multiple levels in response to developmental and environmental cues.

What are the most pressing unanswered questions about A. niger prm1?

Despite advances in fungal biology research, several critical questions about A. niger prm1 remain unanswered:

  • Precise biological role: While homology to yeast Prm1p suggests a role in membrane fusion, the specific cellular processes that require prm1 in the filamentous growth pattern of A. niger remain undefined.

  • Structural determinants of function: The exact structural features that mediate membrane fusion activity, particularly whether the cysteine-mediated dimerization mechanism is conserved from yeast, require further investigation .

  • Regulatory networks: The signaling pathways and transcriptional networks that control prm1 expression during development and stress response are largely unknown.

  • Interaction partners: The complete set of proteins that functionally interact with prm1 to mediate its biological activities remains to be identified.

  • Evolutionary conservation: The degree to which prm1 function is conserved across diverse fungal lineages and how it may have adapted to species-specific requirements would provide insights into fundamental aspects of fungal biology.

Addressing these questions will require integrated approaches combining genetics, biochemistry, structural biology, and cellular imaging techniques.

How might CRISPR-Cas9 gene editing advance functional studies of prm1 in A. niger?

CRISPR-Cas9 technology offers transformative potential for studying prm1 function in A. niger:

  • Precise gene deletions and mutations: CRISPR enables clean deletions or introduction of specific mutations (e.g., cysteine substitutions) without marker genes, allowing for direct assessment of protein function in its native context.

  • Domain swap experiments: CRISPR-mediated homology-directed repair can facilitate the replacement of specific domains within prm1 with corresponding regions from homologs, directly testing functional conservation.

  • Endogenous tagging: Direct fusion of fluorescent proteins or epitope tags to the endogenous prm1 locus ensures physiological expression levels for localization and interaction studies.

  • Conditional expression systems: Integration of inducible promoters at the endogenous locus can create strains where prm1 expression can be temporally controlled to study its role at specific developmental stages.

  • Multiplexed gene editing: Simultaneous modification of prm1 along with potential interacting partners can reveal genetic interactions and functional redundancies.

These approaches overcome limitations of traditional transformation methods in filamentous fungi and allow for more sophisticated genetic analysis similar to approaches that have been successfully applied to other aspects of A. niger biology .

What is the potential for developing prm1-based diagnostic tools for Aspergillus infections?

The development of prm1-based diagnostics for Aspergillus infections represents an intriguing research direction:

  • Serological detection: If prm1 is immunogenic during infection, as observed with other fungal cell surface proteins like Afmp1p, antibodies against specific epitopes could serve as biomarkers for diagnostic assays .

  • PCR-based detection: Species-specific regions within the prm1 gene could serve as targets for PCR-based identification of A. niger in clinical samples, potentially distinguishing it from other Aspergillus species.

  • Protein-based detection systems: If prm1 or fragments thereof are shed during growth, they could potentially be detected in patient samples using specific antibodies in ELISA or lateral flow formats.

  • Comparative genomics approach: Analysis of prm1 sequence variation across clinical isolates could potentially identify markers associated with increased virulence or antifungal resistance.

  • Theranostic applications: Beyond diagnosis, understanding prm1 biology could lead to targeted therapeutic approaches specifically designed for A. niger infections, which represent a significant health concern, particularly in immunocompromised individuals .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.