Recombinant Aspergillus niger Probable endonuclease lcl3 (lcl3)

Shipped with Ice Packs
In Stock

Description

Introduction

Aspergillus niger is a filamentous fungus widely employed in industrial biotechnology for the production of various enzymes, organic acids, and secondary metabolites . Recombinant Aspergillus niger Probable endonuclease lcl3 (lcl3) is a protein identified within this organism, classified as a probable endonuclease with the Enzyme Commission number EC=3.1.-.- . Endonucleases are enzymes that cleave phosphodiester bonds within a nucleic acid molecule, and lcl3 is likely involved in DNA or RNA processing within A. niger .

Characteristics

CharacteristicDescription
NameRecombinant Aspergillus niger Probable endonuclease lcl3 (lcl3)
Source OrganismAspergillus niger (strain CBS 513.88 / FGSC A1513)
Enzyme ClassEndonuclease (EC=3.1.-.-)
Purity>85% (SDS-PAGE)
Source of Recombinant ProductionE. coli or Yeast
UniProt Accession No.A2Q8K8

Function and Biological Role

The precise function of lcl3 in A. niger is not yet fully understood, but as a probable endonuclease, it is likely involved in nucleic acid metabolism . Endonucleases play crucial roles in DNA repair, replication, recombination, and RNA processing. Further research would be required to elucidate the specific substrates and biological pathways in which lcl3 participates within A. niger.

Aspergillus niger in Biotechnology

A. niger has a long history of use in industrial biotechnology due to its ability to secrete large quantities of enzymes and other metabolites . It is used in the production of citric acid, gluconic acid, and various enzymes used in food processing, textile production, and other industries . Genetic and biochemical characterization has been performed on A. niger to improve its production capabilities, including the isolation of protease-deficient mutants to prevent the degradation of target proteins .

Glycosylation in Aspergillus niger

Aspergillus niger enzymes are often glycosylated, which can affect their stability, activity, and interaction with other molecules . Comprehensive glycan analysis of recombinant A. niger enzymes, such as PGC (Plant cell wall Glycosyl hydrolase), has revealed the presence of both N- and O-linked glycosylation . Understanding these post-translational modifications is important for optimizing the production and application of recombinant enzymes from A. niger .

Mutants of Aspergillus niger

Mutants of Aspergillus niger have been isolated and characterized to reduce in vitro degradation of target proteins . Mutants deficient in extracellular protease expression have been isolated and assigned to linkage groups . These mutants are valuable tools for studying the regulation of protease production and for improving the yield of recombinant proteins in A. niger .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
lcl3; An01g04700; Probable endonuclease lcl3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-275
Protein Length
full length protein
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Target Names
lcl3
Target Protein Sequence
MRWPPWASNTQASNNDHPTTTNNNDPKNLLDWSAFTELRTLIPTLVLTTGILSAFTLHRN YLRRFPTAVNITPAYYRRRSILGKVTSVGDGDNFRIYHTPGGRLAGWGWVPWKKVPTTRK ELRDQTIHVRIAGVDAPEQAHFGRPAQPFGKEAHEWLTGYLINRRVRIYVHRQDQYQRVV ATVFVRRALDFPVPFRRRDVGYEMLRKGLATVYEAKVGAEFGGEVMEKKYRSAEWWAKAR GLGLWKGFKKNRDAWESPREFKTRTGMEDVGDGKK
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Aspergillus niger Probable endonuclease lcl3 and what are its key properties?

Recombinant Aspergillus niger Probable endonuclease lcl3 (lcl3) is a protein identified within the Aspergillus niger organism, classified as a probable endonuclease with the Enzyme Commission number EC=3.1.-.-. Endonucleases are enzymes that cleave phosphodiester bonds within nucleic acid molecules, and lcl3 is likely involved in DNA or RNA processing within A. niger. The protein has the following key characteristics:

CharacteristicDescription
Source OrganismAspergillus niger (strain CBS 513.88 / FGSC A1513)
Enzyme ClassEndonuclease (EC=3.1.-.-)
UniProt AccessionA2Q8K8
Purity>85% (SDS-PAGE)
Source of Recombinant ProductionE. coli or Yeast
Molecular WeightNot fully specified in available literature

The precise function of lcl3 in A. niger is not yet fully characterized, but as a probable endonuclease, it is likely involved in nucleic acid metabolism including DNA repair, replication, recombination, and RNA processing.

How should Recombinant Aspergillus niger Probable endonuclease lcl3 be stored and handled for optimal stability?

For optimal stability and activity retention, the following storage and handling protocols are recommended:

  • Short-term storage: Store working aliquots at 4°C for up to one week .

  • Long-term storage: Store at -20°C, or for extended storage, conserve at -20°C or -80°C .

  • Storage format considerations:

    • The shelf life of liquid form preparations is approximately 6 months at -20°C/-80°C

    • The shelf life of lyophilized form preparations is approximately 12 months at -20°C/-80°C

  • Freeze-thaw management: Repeated freezing and thawing is not recommended .

  • Reconstitution protocol: Briefly centrifuge the vial prior to opening to bring contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) and aliquot for long-term storage .

These guidelines ensure maintenance of structural integrity and enzymatic activity for experimental applications.

What are the recommended experimental conditions for assessing endonuclease activity of Recombinant Aspergillus niger lcl3?

While the specific activity assays for Recombinant Aspergillus niger Probable endonuclease lcl3 are not directly detailed in the provided literature, based on standard endonuclease assay protocols and experimental approaches used with similar enzymes, the following methodology is recommended:

  • Buffer selection: Test activity in various buffers (Tris, HEPES, phosphate) at pH ranges from 6.5-8.5, with optimal conditions likely similar to other fungal endonucleases.

  • Substrate preparation: Prepare labeled or unlabeled DNA/RNA substrates. Circular plasmid DNA is often used to assess conversion from supercoiled to nicked or linear forms.

  • Incubation: 10-60 minutes at 37°C (though temperature optimization may be required).

  • Analysis method: Agarose gel electrophoresis for DNA substrates, or polyacrylamide gel electrophoresis for RNA or smaller DNA fragments.

Since A. niger enzymes are often glycosylated, which affects their stability and activity , testing under various ionic strengths and with potential stabilizing agents like BSA or glycerol may help establish optimal conditions.

How can Recombinant Aspergillus niger lcl3 be purified with minimal loss of activity?

Based on established purification protocols for similar recombinant enzymes from Aspergillus niger, the following methodological approach is recommended:

  • Initial expression considerations:

    • Express in appropriate host system (E. coli is commonly used as documented in available sources )

    • Include appropriate affinity tags if not interfering with enzyme function

    • Consider codon optimization for the expression host

  • Cell lysis and initial extraction:

    • Use gentle lysis methods (sonication with cooling intervals or enzymatic lysis)

    • Include protease inhibitors to prevent degradation

    • Maintain cold temperatures (4°C) throughout purification

  • Chromatography sequence:

    • Initial capture: Affinity chromatography if tagged; otherwise ion exchange

    • Intermediate purification: Size exclusion chromatography

    • Polishing: Reverse phase or hydrophobic interaction chromatography

  • Activity preservation measures:

    • Include 10-20% glycerol in all buffers to maintain stability

    • Consider including stabilizing agents (0.1% BSA, 1-5 mM DTT, or 0.1-1 mM EDTA)

    • Monitor and adjust pH to optimal range (typically 7.0-7.5)

  • Quality assessment:

    • Confirm purity via SDS-PAGE (target >85% as specified for commercial preparations)

    • Verify activity using the endonuclease assay described above

    • Check for glycosylation patterns which may affect function

How can sequence alignment and structural analysis be used to predict substrate specificity of Recombinant Aspergillus niger lcl3?

To predict substrate specificity of Recombinant Aspergillus niger lcl3 through sequence alignment and structural analysis, researchers should employ the following methodological approach:

  • Multiple sequence alignment:

    • Align the lcl3 amino acid sequence (from UniProt accession A2Q8K8) with characterized endonucleases from various species

    • Focus on conserved catalytic domains and substrate-binding regions

    • Include homologous enzymes with known specificity from fungi, particularly Aspergillus species

  • Domain identification:

    • Identify conserved motifs characteristic of specific endonuclease families

    • Map potential active site residues based on homology to known structures

  • Structural prediction and analysis:

    • Generate 3D structural models using homology modeling or AI-based structure prediction tools

    • Analyze the electrostatic potential of the predicted active site to identify positively charged regions for DNA/RNA binding

    • Examine the catalytic pocket dimensions to infer size constraints on substrates

  • Validation strategies:

    • Design multiple substrate variants with systematic sequence or structural variations

    • Perform comparative kinetic analysis on different substrates

    • Utilize site-directed mutagenesis of predicted specificity-determining residues to confirm their role

This comprehensive analysis would provide insights into the substrate preferences and potential specialized functions of lcl3 within the biological context of A. niger.

What strategies can be employed to overcome expression challenges when producing high-yield Recombinant Aspergillus niger lcl3 in heterologous hosts?

Based on studies of heterologous expression systems for fungal enzymes, including work with A. niger recombinant enzymes, researchers can employ these methodological strategies to overcome expression challenges:

  • Host selection considerations:

    • E. coli systems: Optimize for prokaryotic expression by codon optimization, reduced formation of inclusion bodies, and proper folding

    • Yeast systems: S. cerevisiae or P. pastoris may provide better post-translational modifications

    • Filamentous fungi hosts: Consider using protease-deficient A. niger strains as expression hosts for homologous expression

  • Gene optimization strategies:

    • Codon optimization based on host preference

    • Removal of rare codons and potential internal regulatory sequences

    • Optimization of GC content and mRNA secondary structures

    • Inclusion of appropriate signal sequences for secretion

  • Expression vector design:

    • Promoter selection: Strong inducible promoters like T7 for E. coli or TAKA amylase promoter for Aspergillus systems

    • Selection of appropriate secretion signals if targeting extracellular production

    • Fusion tag selection to enhance solubility (e.g., SUMO, MBP, thioredoxin)

  • Culture optimization:

    • Temperature modulation (often lower temperatures improve folding)

    • Media composition adjustments based on carbon source preferences

    • Induction timing and concentration optimization

    • For fungal hosts, consider carbon-limited chemostat cultivations

  • Addressing common challenges:

    • Protein retention in cell wall: Based on findings with other A. niger recombinant enzymes, significant amounts may be retained in the cell wall rather than secreted

    • Glycosylation differences: If glycosylation is critical for function, consider using fungal or mammalian expression systems

    • Proteolytic degradation: Include protease inhibitors or use protease-deficient strains

When implementing these strategies, researchers should note that in previous studies with recombinant enzymes in A. niger, the heterologous enzyme accounted for about 1% of all cellular protein being produced by the cells under optimized conditions .

How does Recombinant Aspergillus niger lcl3 compare functionally to homologous endonucleases from other fungal species?

To systematically compare the functional properties of Recombinant Aspergillus niger lcl3 with homologous endonucleases from other fungal species, researchers should employ the following methodological approach:

  • Evolutionary and sequence comparison:

    • Conduct phylogenetic analysis including lcl3 homologs from various fungal species

    • Compare sequence conservation patterns, focusing on catalytic residues

    • Analyze predicted structural features across species

  • Comparative biochemical characterization:

    • Express and purify homologous enzymes from multiple species under identical conditions

    • Compare enzymatic parameters using standardized assays:

    ParameterA. niger lcl3A. oryzae lcl3A. flavus lcl3S. cerevisiae LCL3
    pH optimumNot yet determinedData neededData neededData needed
    Temperature optimumNot yet determinedData neededData neededData needed
    Substrate specificityNot yet determinedData neededData neededData needed
    Kinetic parametersNot yet determinedData neededData neededData needed
    Cofactor requirementsNot yet determinedData neededData neededData needed

    Note: The commercial availability of homologous proteins from related species such as A. oryzae, A. flavus, and S. cerevisiae is indicated in the search results , facilitating direct comparative studies.

  • Functional context analysis:

    • Investigate the biological role of lcl3 homologs in different fungal species through knockdown/knockout studies

    • Compare expression patterns under various growth conditions and stress responses

    • Analyze potential species-specific adaptations in endonuclease function

  • Structural basis for functional differences:

    • Generate comparative structural models of homologs

    • Identify species-specific structural features that might explain functional differences

    • Use site-directed mutagenesis to test hypotheses about structure-function relationships

Such comparative studies would provide insights into the evolutionary conservation and divergence of lcl3 function across fungal species, with implications for understanding the biological role of this endonuclease family.

What are the potential biological roles of Recombinant Aspergillus niger lcl3 in the context of fungal nucleic acid metabolism?

Based on knowledge of endonucleases in fungal systems and the available information on lcl3, the following methodological approaches can elucidate its biological roles:

  • Genomic context analysis:

    • Examine the genomic neighborhood of the lcl3 gene in A. niger

    • Identify co-regulated genes through transcriptomic analysis

    • Determine if lcl3 is part of any characterized biosynthetic gene clusters (BGCs)

  • Expression pattern characterization:

    • Analyze lcl3 expression under various growth conditions using RT-qPCR

    • Determine if expression correlates with specific cellular processes (e.g., DNA damage, replication, sporulation)

    • Investigate if lcl3 expression is responsive to nucleic acid damaging agents

  • Subcellular localization:

    • Generate fluorescently tagged lcl3 for in vivo localization studies

    • Perform cell fractionation followed by Western blot analysis

    • Correlate localization patterns with potential functions (nuclear for DNA processing, cytoplasmic for RNA metabolism)

  • Interaction network mapping:

    • Conduct pull-down assays or co-immunoprecipitation to identify protein interaction partners

    • Perform crosslinking studies to identify nucleic acid substrates in vivo

    • Map the complete interactome to place lcl3 in the context of known cellular pathways

  • Functional disruption studies:

    • Generate lcl3 knockout or knockdown strains in A. niger

    • Analyze phenotypic consequences under various growth and stress conditions

    • Perform rescue experiments with site-directed mutants to pinpoint critical residues

  • Secondary metabolism connections:

    • Investigate potential roles in the regulation of biosynthetic gene clusters, given that A. niger contains 86 BGCs with complex regulatory networks

    • Examine if lcl3 influences the production of secondary metabolites through nucleic acid processing

These approaches would provide comprehensive insights into the biological significance of lcl3 in A. niger cellular processes and potentially reveal novel functions beyond conventional endonuclease activity.

What experimental approaches can be used to elucidate the catalytic mechanism of Recombinant Aspergillus niger lcl3?

To systematically investigate the catalytic mechanism of Recombinant Aspergillus niger lcl3, researchers should employ these methodological approaches:

  • Structural determination:

    • X-ray crystallography of lcl3 in apo-form and in complex with substrate analogs or inhibitors

    • Cryo-EM analysis for capturing dynamic states during catalysis

    • NMR spectroscopy for solution structure and detecting conformational changes

  • Catalytic residue identification:

    • Site-directed mutagenesis of predicted catalytic residues

    • Activity assays with mutant enzymes to quantify the impact of specific residues

    • pH-rate profiles to identify ionizable groups essential for catalysis

    • Chemical modification studies targeting specific amino acid types

  • Reaction mechanism investigation:

    • Kinetic isotope effect studies to identify rate-determining steps

    • Pre-steady-state kinetics to identify reaction intermediates

    • Solvent isotope effects to probe proton transfer steps

    • Temperature-dependent kinetics to determine activation parameters

  • Metal ion and cofactor requirements:

    • ICP-MS analysis to identify bound metal ions

    • Activity assays with various metal ions to determine specificity

    • Chelation studies to assess the requirement for metal ions in catalysis

  • Substrate binding and recognition:

    • Isothermal titration calorimetry (ITC) to measure binding thermodynamics

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Fluorescence anisotropy with labeled substrates to analyze binding interactions

    • Molecular dynamics simulations to model substrate-enzyme interactions

These approaches would collectively provide a comprehensive understanding of how lcl3 achieves its catalytic function and how it compares mechanistically to other endonucleases.

How do post-translational modifications affect the structure and function of Recombinant Aspergillus niger lcl3?

Based on studies of other A. niger enzymes and what is known about fungal endonucleases, the following methodological approach would elucidate the impact of post-translational modifications (PTMs) on lcl3:

  • Comprehensive PTM mapping:

    • Use mass spectrometry-based approaches similar to those employed for PGC enzyme analysis :

      • MALDI-TOF mass spectrometry

      • LC-ion trap mass spectrometry

      • LC-ESI mass spectrometry

    • Employ trypsin degradation and beta-elimination followed by Michael addition with dithiothreitol (BEMAD) techniques

    • Map specific sites of glycosylation, phosphorylation, and other modifications

  • Glycosylation analysis:

    • Given that A. niger enzymes are often glycosylated , characterize both N-linked and O-linked glycans

    • Compare glycosylation patterns between native and recombinant lcl3 from different expression systems

    • Assess the impact of deglycosylation on enzymatic activity, stability, and substrate binding

  • Structure-function correlation:

    • Generate 3D models showing the spatial distribution of PTMs on the protein structure

    • Analyze how PTMs affect surface properties, including electrostatic potential and hydrophobicity

    • Examine if PTMs occur near the active site or substrate binding regions

  • Engineered variants analysis:

    • Create site-directed mutants at PTM sites to prevent modification

    • Express lcl3 in systems with different glycosylation capabilities

    • Compare enzymatic parameters (kcat, KM, stability) between variants with different PTM profiles

  • Biological significance assessment:

    • Investigate if PTMs on lcl3 affect protein-protein interactions

    • Determine if PTMs influence subcellular localization or trafficking

    • Assess if PTMs are regulated in response to cellular conditions or stresses

This systematic approach would provide insights into how PTMs influence lcl3 function, similar to findings with other A. niger enzymes where glycosylation has been shown to modulate interactions with other macromolecules .

What potential applications exist for Recombinant Aspergillus niger lcl3 in molecular biology research?

Based on the properties of endonucleases and the specific characteristics of Recombinant Aspergillus niger lcl3, several potential research applications can be methodologically explored:

  • Nucleic acid manipulation tools:

    • Characterize substrate specificity to determine potential as a restriction enzyme alternative

    • Develop protocols for site-specific DNA/RNA cleavage applications

    • Explore utility in genomic DNA fragmentation for next-generation sequencing library preparation

  • Structural studies of nucleic acids:

    • Employ lcl3 for probing accessible regions in chromatin or RNA secondary structures

    • Develop footprinting assays using lcl3 partial digestion to map protein-nucleic acid interactions

    • Utilize for structural accessibility studies of complex nucleic acid structures

  • Synthetic biology applications:

    • Engineer lcl3 variants with altered specificity through directed evolution

    • Develop inducible nuclease systems for synthetic genetic circuits

    • Create programmable nucleases by fusion with DNA/RNA binding domains

  • Analytical techniques:

    • Develop lcl3-based assays for detecting specific nucleic acid structures or modifications

    • Create biosensor systems utilizing lcl3 activity as a reporter

    • Establish lcl3-mediated amplification techniques for sensitive detection methods

  • Studies of fungal biology:

    • Use lcl3 as a model to understand fungal nucleic acid metabolism

    • Investigate its role in the comprehensive regulation of secondary metabolism in A. niger

    • Explore connections to biosynthetic gene clusters and their regulation

Each application would require development of specific protocols and optimization for the particular use case, building on the established biochemical properties of lcl3.

How can directed evolution approaches be applied to engineer Recombinant Aspergillus niger lcl3 with enhanced or novel properties?

To engineer Recombinant Aspergillus niger lcl3 with enhanced or novel properties through directed evolution, researchers should implement the following methodological framework:

  • Library generation strategies:

    • Error-prone PCR with controlled mutation rates

    • DNA shuffling with homologous enzymes from other fungal species

    • Focused mutagenesis of active site and substrate-binding regions

    • Semi-rational design combining computational prediction with targeted diversity

  • Selection/screening system development:

    • Design high-throughput fluorescence-based assays for endonuclease activity

    • Develop selection systems linking survival to desired enzymatic properties

    • Create reporter systems that detect specific nuclease activities

    • Implement microfluidic platforms for single-variant analysis

  • Iterative improvement process:

    • Conduct multiple rounds of mutation and selection

    • Perform recombination of beneficial mutations

    • Implement machine learning algorithms to guide evolution

    • Alternate between positive and negative selection to refine specificity

  • Desired property targets:

    • Enhanced thermostability (building on A. niger's natural thermostability observed in other enzymes )

    • Altered substrate specificity

    • Increased catalytic efficiency

    • Reduced dependency on specific cofactors

    • Enhanced resistance to inhibitors

  • Variant characterization:

    • Deep sequencing to identify enriched mutations

    • Comprehensive biochemical characterization of improved variants

    • Structural analysis to understand the molecular basis of improvements

    • In vitro and in vivo validation of enhanced properties

This approach leverages the natural diversity of fungal endonucleases and the adaptability of A. niger enzymes to create novel biocatalysts with tailored properties for research and biotechnological applications.

What are the key quality control parameters that should be assessed when working with Recombinant Aspergillus niger lcl3?

To ensure experimental reproducibility and reliability when working with Recombinant Aspergillus niger lcl3, researchers should implement the following quality control methodology:

  • Purity assessment:

    • SDS-PAGE analysis with Coomassie or silver staining (target >85% purity)

    • Mass spectrometry to confirm protein identity and detect contaminants

    • Size exclusion chromatography to assess aggregation state

    • Endotoxin testing if intended for sensitive applications

  • Structural integrity verification:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Intrinsic fluorescence spectroscopy to assess tertiary structure

    • Thermal shift assays to determine stability

    • Dynamic light scattering to detect aggregation

  • Post-translational modification analysis:

    • Glycosylation analysis using specialized staining or mass spectrometry

    • Verification of correct signal sequence cleavage

    • Assessment of other potential modifications (phosphorylation, acetylation)

  • Functional validation:

    • Standardized activity assay with reference substrate

    • Determination of specific activity (units/mg protein)

    • Assessment of enzyme kinetics (KM, kcat)

    • Stability testing under storage and experimental conditions

  • Batch-to-batch consistency:

    • Maintain detailed records of expression and purification conditions

    • Develop reference standards for comparative analysis

    • Implement statistical quality control methods to track variation

    • Establish acceptance criteria for critical parameters

By implementing these quality control measures, researchers can ensure that experimental outcomes are due to the intrinsic properties of lcl3 rather than variability in reagent quality or integrity.

What are the most effective methods for troubleshooting activity loss in Recombinant Aspergillus niger lcl3 preparations?

When faced with activity loss in Recombinant Aspergillus niger lcl3 preparations, researchers should employ this systematic troubleshooting methodology:

  • Stability assessment:

    • Implement accelerated stability studies under various conditions

    • Monitor activity retention during storage at different temperatures

    • Assess freeze-thaw stability with multiple cycles

    • Evaluate pH stability across the relevant range

  • Buffer component optimization:

    • Test multiple buffer systems (HEPES, Tris, phosphate) for compatibility

    • Evaluate the impact of ionic strength on stability

    • Screen stabilizing additives:

      • Glycerol (10-50%)

      • Reducing agents (DTT, β-mercaptoethanol)

      • Protein stabilizers (BSA, gelatin)

      • Metal ions (Mg²⁺, Mn²⁺, Zn²⁺)

  • Structural analysis of inactive preparations:

    • Compare CD spectra of active vs. inactive preparations

    • Analyze aggregation state using DLS or native PAGE

    • Assess oxidation state of critical residues

    • Evaluate glycosylation status changes during storage

  • Contaminant and inhibitor identification:

    • Test for presence of proteases using fluorescent substrates

    • Evaluate metal chelator contamination

    • Screen for microbial contamination

    • Assess product inhibition by reaction products

  • Process optimization:

    • Modify purification protocols to minimize exposure to destabilizing conditions

    • Implement immediate stabilization post-purification

    • Optimize concentration methods to prevent aggregation

    • Consider alternative formulation strategies:

    Storage ConditionAnticipated StabilityRecommended Additives
    4°C (short-term)1 week 10% glycerol, buffer at optimal pH
    -20°C (medium-term)6 months (liquid) 50% glycerol, protective proteins
    -80°C (long-term)12 months (lyophilized) Lyoprotectants, controlled reconstitution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.