Recombinant Aspergillus niger Solute carrier family 25 member 38 homolog (An01g07650)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

An01g07650 is a 315-amino-acid protein encoded in the Aspergillus niger genome. It shares homology with mitochondrial carrier proteins across eukaryotes, including yeast (Yarrowia lipolytica, Saccharomyces cerevisiae) and mammals . Recombinant production involves full-length expression in Escherichia coli with a C-terminal His-tag for purification .

Key Properties

ParameterValue
Gene IDANI_1_2744014
Host SystemE. coli
TagPolyhistidine (His-tag)
Protein LengthFull length (1–315 residues)
Molecular FunctionMitochondrial metabolite transport

2.1. Predicted Substrate Specificity

SLC25 members typically transport nucleotides, amino acids, or ions. While direct experimental data for An01g07650 is limited, homology modeling suggests involvement in:

  • Citrate metabolism: A. niger strains exhibit genetic redundancy in citrate synthase enzymes, critical for citric acid overproduction .

  • Secondary metabolite synthesis: Over 1,100 A. niger-specific enzymes are linked to pathways for aromatic compound degradation and secondary metabolites .

2.2. Genomic Context

Comparative genomics reveals that A. niger possesses unique metabolic genes absent in related fungi (A. fumigatus, A. oryzae) . An01g07650 is part of a broader network of mitochondrial transporters, potentially enhancing metabolic flexibility under industrial fermentation conditions .

3.1. Citric Acid Production

A. niger is the primary industrial producer of citric acid. Genetic engineering strategies targeting mitochondrial transporters like An01g07650 could optimize flux through the TCA cycle . Strains with modified SLC25 proteins show enhanced organic acid yields under low-oxygen conditions .

3.2. Heterologous Protein Expression

Recombinant An01g07650 serves as a tool for studying mitochondrial transport mechanisms. Its high purity (≥85%) and solubility make it suitable for in vitro assays .

Industrial Relevance

Application AreaPotential Role of An01g07650
Organic Acid SynthesisModulating mitochondrial substrate supply for citrate overproduction
Secondary Metabolite EngineeringTransport of precursors for polyketides or nonribosomal peptides

Research Gaps and Future Directions

  • Substrate profiling: No experimental data confirm the specific metabolites transported by An01g07650.

  • CRISPR-based studies: Gene-editing tools like Cas9/sgRNA systems could elucidate its role in A. niger metabolism.

  • Structural studies: Cryo-EM or X-ray crystallography would resolve its transport mechanism.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preference in the order notes and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is preferred, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, aliquots can be stored at 4°C for up to one week.
Reconstitution
To ensure optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquotting is recommended to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the product with your designated tag.
Synonyms
An01g07650; Mitochondrial glycine transporter; Solute carrier family 25 member 38 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-315
Protein Length
full length protein
Species
Aspergillus niger (strain CBS 513.88 / FGSC A1513)
Target Names
An01g07650
Target Protein Sequence
MSNNAVYAVPQVKTTKTSSKTTFHFTAGLFSGLTSSILLQPADLLKTRVQQSQNASLLPT VKAILSSPNPIRNLWRGTLPSALRTGFGSALYFTSLNALRTGLVQTNGIAPVTNSSSALP KLSNTANLATGAAARVAAGFVMMPVTVIKVRYESDYYAYRSLFGAGRDIVRTEGFRGLFS GFGATAARDAPYAGLYVLFYEQLKRRLAGLSSSSSDQQPLKSSSINFVSGGLAAGLATTI TNPFDAVKTRLQLMPGRYGNMMRAVRLMVQEDGVRSLFGGLGLRITRKALSSALAWTVYE ELILRAEVQWGSKGE
Uniprot No.

Target Background

Function
This mitochondrial glycine transporter facilitates the import of glycine into the mitochondrial matrix. It plays a critical role in providing glycine for the first enzymatic step in heme biosynthesis, the condensation of glycine with succinyl-CoA to produce 5-aminolevulinate (ALA) within the mitochondrial matrix.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family, SLC25A38 subfamily
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What methodologies are recommended for reconstitution and storage of the recombinant protein?

For optimal reconstitution of Recombinant Aspergillus niger Solute Carrier Family 25 Member 38 Homolog, the following methodological approach is recommended:

  • Initial preparation: Briefly centrifuge the vial prior to opening to bring contents to the bottom.

  • Reconstitution protocol: Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Storage preparation: Add glycerol to a final concentration of 5-50% (standard recommendation is 50%) and aliquot for long-term storage.

  • Storage conditions: Store working aliquots at 4°C for up to one week. For long-term storage, keep at -20°C/-80°C.

  • Stability considerations: Avoid repeated freeze-thaw cycles as they may compromise protein integrity and functionality .

The reconstituted protein is suspended in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which maintains stability during storage periods . Researchers should conduct preliminary stability tests if their specific experimental conditions differ significantly from these recommendations.

How does the An01g07650 gene relate to citric acid production in Aspergillus niger, and what methodological approaches can be used to study this relationship?

The relationship between An01g07650 (Solute Carrier Family 25 Member 38 Homolog) and citric acid production in Aspergillus niger should be considered in the context of metabolic regulation networks. While specific direct connections between An01g07650 and citric acid production are not explicitly documented in the provided research, studies on A. niger have revealed that regulatory genes like LaeA significantly impact citric acid production and secondary metabolite regulation .

Methodological approaches to investigate this relationship include:

  • Gene expression analysis: Quantify An01g07650 expression levels under citric acid-producing conditions using RT-qPCR or RNA-seq, comparing wild-type strains with citric acid production mutants.

  • Genetic manipulation studies: Generate knockout or overexpression strains of An01g07650 using CRISPR-Cas9 or traditional transformation methods to assess the impact on citric acid production.

  • Metabolic flux analysis: Combine C13-labeled substrate feeding with mass spectrometry to track carbon flow through central metabolism in wild-type versus An01g07650-modified strains.

  • Protein-protein interaction studies: Use co-immunoprecipitation or yeast two-hybrid systems to identify potential interactions between An01g07650 and known citric acid production regulators like LaeA.

  • Systems biology approach: Integrate transcriptomic, proteomic, and metabolomic data to position An01g07650 within the broader metabolic network controlling citric acid production .

Recent research has demonstrated that regulatory elements like LaeA are required for citric acid production in A. niger, suggesting that mitochondrial transporters may play roles in this industrial process through their influence on metabolic pathways .

What is the relationship between An01g07650 and secondary metabolite production in Aspergillus niger?

The relationship between An01g07650 (Solute Carrier Family 25 Member 38 Homolog) and secondary metabolite production likely involves mitochondrial transport mechanisms that influence metabolic precursor availability. While the provided research doesn't directly address An01g07650's specific role, studies on similar regulatory systems in A. niger provide valuable insights.

Research on the LaeA methyltransferase-domain protein has demonstrated that regulatory factors significantly impact both citric acid production and secondary metabolite profiles in A. niger. When LaeA was deleted (ΔlaeA strain), researchers observed both decreases and increases in various secondary metabolite levels compared to wild-type strains . This suggests complex regulatory networks controlling secondary metabolism that may involve mitochondrial transporters like An01g07650.

To investigate An01g07650's role in secondary metabolism, researchers should consider:

  • Comparative metabolomics: Use HPLC-MS or LC-MS/MS to generate secondary metabolite profiles from wild-type A. niger versus An01g07650 knockout/overexpression strains.

  • Gene cluster analysis: Determine whether An01g07650 expression correlates with the activation of specific secondary metabolite biosynthetic gene clusters.

  • Mitochondrial transport assays: Develop in vitro transport assays using purified recombinant An01g07650 to identify specific substrates relevant to secondary metabolism.

  • Isotope labeling studies: Trace the incorporation of isotope-labeled precursors into secondary metabolites in the presence or absence of functional An01g07650.

This experimental approach would elucidate whether An01g07650, as a mitochondrial glycine transporter, influences secondary metabolism through precursor availability, redox balance, or other regulatory mechanisms .

What are the key variables to control when designing experiments involving recombinant An01g07650 protein?

When designing experiments with recombinant Aspergillus niger Solute Carrier Family 25 Member 38 Homolog (An01g07650), researchers must implement rigorous controls to ensure reliable results. The experimental design should account for the following key variables:

  • Protein preparation variables:

    • Expression system consistency (E. coli strain and growth conditions)

    • Purification method standardization (affinity chromatography parameters)

    • Protein concentration determination (method consistency)

    • Storage buffer composition and pH (Tris/PBS-based buffer, pH 8.0)

  • Experimental condition variables:

    • Temperature (maintain consistent temperature during assays)

    • pH (control for optimal protein activity)

    • Substrate concentrations (determine Michaelis-Menten kinetics)

    • Cofactor requirements (identify necessary ions or molecules)

  • Control variables:

    • Negative controls (inactive protein or buffer-only controls)

    • Positive controls (known mitochondrial transporter with established activity)

    • Technical replicates (minimum triplicate measurements)

    • Biological replicates (protein from independent expressions)

The experimental design should follow these principles:

PrincipleApplication to An01g07650 Research
RandomizationRandomly assign samples to treatment groups to minimize bias
ReplicationPerform multiple independent experiments with freshly prepared protein
BlockingGroup experimental units to reduce variability from nuisance factors
Factorial designTest multiple variables simultaneously to identify interactions
Positive/negative controlsInclude known transporters and buffer-only controls

How should researchers address contradictions in experimental data when studying An01g07650 function?

When researchers encounter contradictory data in studies of Recombinant Aspergillus niger Solute Carrier Family 25 Member 38 Homolog (An01g07650), a systematic approach to resolving these contradictions is essential. Contradictions may arise from technical variations, biological complexities, or misinterpretations of results. The following methodological framework helps address such contradictions:

  • Data validation and verification:

    • Re-examine raw data and statistical analyses for errors

    • Verify protein identity using mass spectrometry

    • Confirm protein activity using complementary assays

    • Check for batch-to-batch variations in protein preparations

  • Experimental design reassessment:

    • Evaluate whether the experimental design adequately controls for confounding variables

    • Consider whether the chosen methodology is appropriate for the specific research question

    • Implement alternative approaches to test the same hypothesis

  • Biological context consideration:

    • Assess whether contradictions reflect genuine biological complexity rather than technical errors

    • Consider post-translational modifications that might affect protein function

    • Evaluate potential interactions with other cellular components

  • Reconciliation strategies:

    • Design experiments that directly address the contradictions

    • Develop more sensitive or specific assays to resolve ambiguities

    • Integrate multiple data types (functional, structural, genetic) to build a comprehensive model

  • Transparent reporting:

    • Present all contradictory data with appropriate statistical analyses

    • Discuss alternative interpretations of the results

    • Acknowledge limitations of the methodologies used

This approach aligns with best practices in scientific research, recognizing that contradictions often lead to deeper insights when systematically investigated rather than ignored .

What statistical approaches are most appropriate for analyzing transport kinetics data for An01g07650?

When analyzing transport kinetics data for Recombinant Aspergillus niger Solute Carrier Family 25 Member 38 Homolog (An01g07650), researchers should employ appropriate statistical methods that account for the unique characteristics of transporter data. The following statistical approach is recommended:

  • Michaelis-Menten kinetics analysis:

    • Use non-linear regression to determine Km and Vmax parameters

    • Calculate substrate affinity (1/Km) and maximum transport rate (Vmax)

    • Apply Eadie-Hofstee or Lineweaver-Burk transformations for visual inspection of data

    • Report 95% confidence intervals for all kinetic parameters

  • Comparison of experimental conditions:

    • Apply ANOVA for comparing multiple treatment conditions

    • Use post-hoc tests (Tukey's HSD or Bonferroni correction) to identify specific differences

    • For two-condition comparisons, use Student's t-test with appropriate corrections for multiple testing

  • Data presentation in tables:

    Transport ParameterValue95% Confidence IntervalExperimental Conditions
    Km (μM)[value][lower-upper]pH X, temperature Y°C
    Vmax (nmol/min/mg)[value][lower-upper]pH X, temperature Y°C
    Inhibition constant (Ki)[value][lower-upper][inhibitor] at Z μM
  • Time-series analysis:

    • Apply repeated measures ANOVA for time-dependent transport assays

    • Consider non-parametric alternatives if normality assumptions are violated

    • Use mixed-effects models to account for random and fixed effects

  • Validation and robustness testing:

    • Perform sensitivity analyses to identify influential data points

    • Apply bootstrapping techniques to estimate parameter confidence

    • Validate models with independent datasets when possible

How can researchers effectively present complex data on An01g07650 function in scientific publications?

Effective presentation of complex data on Recombinant Aspergillus niger Solute Carrier Family 25 Member 38 Homolog (An01g07650) in scientific publications requires careful attention to clarity, precision, and adherence to established formatting conventions. The following methodological approach ensures optimal data presentation:

This comprehensive approach ensures that complex data on An01g07650 function is presented in a manner that is accessible, accurate, and aligned with scientific publication standards .

What are common challenges in expressing and purifying functional An01g07650, and how can they be addressed?

Researchers working with Recombinant Aspergillus niger Solute Carrier Family 25 Member 38 Homolog (An01g07650) frequently encounter several challenges during expression and purification. The following methodological approaches address these challenges:

  • Protein misfolding and inclusion body formation:

    • Challenge: As a membrane protein, An01g07650 may form inclusion bodies in E. coli.

    • Solution: Optimize expression conditions by lowering cultivation temperature (16-20°C), using specialized E. coli strains (C41, C43, Rosetta), or adding solubility-enhancing fusion tags (SUMO, MBP) in addition to the His-tag .

    • Alternative approach: Consider cell-free expression systems if in vivo expression consistently yields misfolded protein.

  • Low protein yield:

    • Challenge: Membrane proteins often express at lower levels than soluble proteins.

    • Solution: Optimize codon usage for E. coli, use strong but controllable promoters (T7), and enrich growth media with appropriate supplements.

    • Verification step: Confirm expression using Western blot before proceeding to large-scale cultures.

  • Protein instability:

    • Challenge: The native mitochondrial environment differs significantly from in vitro conditions.

    • Solution: Stabilize the purified protein with appropriate detergents or lipid nanodiscs.

    • Storage protocol: Store with 6% trehalose in Tris/PBS buffer at pH 8.0, and avoid repeated freeze-thaw cycles .

  • Purification interference:

    • Challenge: Contaminant proteins may co-purify with His-tagged An01g07650.

    • Solution: Implement a two-step purification strategy combining immobilized metal affinity chromatography (IMAC) with size exclusion chromatography (SEC).

    • Quality control: Verify purity by SDS-PAGE (>90% purity should be achievable) .

  • Functional activity loss:

    • Challenge: Purified protein may lose transport activity during purification.

    • Solution: Reconstitute the protein into proteoliposomes to restore a membrane-like environment for functional studies.

    • Validation step: Confirm activity using transport assays with radiolabeled or fluorescent substrates.

These methodological solutions are based on established practices in membrane protein biochemistry and the specific characteristics of the An01g07650 protein as documented in research protocols .

How can researchers investigate potential regulatory interactions between An01g07650 and LaeA in Aspergillus niger?

Investigating potential regulatory interactions between An01g07650 (Solute Carrier Family 25 Member 38 Homolog) and LaeA in Aspergillus niger requires a comprehensive experimental approach that integrates genetic, biochemical, and systems biology methods. The following methodological framework provides a strategic approach to this complex research question:

  • Co-expression analysis:

    • Methodology: Perform RNA-seq or RT-qPCR analysis under various growth conditions.

    • Analysis approach: Calculate Pearson or Spearman correlation coefficients between An01g07650 and LaeA expression levels.

    • Expected outcome: Strong correlation would suggest co-regulation or functional relationship.

    • Control validation: Include known LaeA-regulated genes as positive controls .

  • Genetic interaction studies:

    • Methodology: Generate single and double knockout strains (ΔAn01g07650, ΔlaeA, and ΔAn01g07650/ΔlaeA).

    • Analysis approach: Compare phenotypes, focusing on citric acid production and secondary metabolite profiles.

    • Expected outcome: Epistatic interactions would suggest functional relationships in the same pathway.

    • Data presentation:

      StrainCitric Acid ProductionSecondary Metabolite ProfileGrowth Rate
      Wild-typeBaselineBaselineBaseline
      ΔAn01g07650[Change %][Pattern changes][Change %]
      ΔlaeA[Change %][Pattern changes][Change %]
      ΔAn01g07650/ΔlaeA[Change %][Pattern changes][Change %]
  • Protein-protein interaction analysis:

    • Methodology: Implement yeast two-hybrid or co-immunoprecipitation studies.

    • Analysis approach: Detect direct physical interactions between An01g07650 and LaeA.

    • Technical consideration: As An01g07650 is a membrane protein, consider split-ubiquitin Y2H systems designed for membrane proteins.

    • Control validation: Include known interacting and non-interacting protein pairs.

  • Metabolic impact assessment:

    • Methodology: Perform metabolomic analysis of wild-type versus mutant strains.

    • Analysis approach: Identify shifts in intracellular metabolite pools, particularly those related to mitochondrial metabolism.

    • Technical consideration: Use stable isotope labeling to track carbon flux through central metabolism.

    • Integration step: Correlate metabolic changes with citric acid production and secondary metabolite levels .

  • Chromatin immunoprecipitation (ChIP) analysis:

    • Methodology: Determine if LaeA affects chromatin state at the An01g07650 locus.

    • Analysis approach: Compare histone modifications at the An01g07650 promoter in wild-type versus ΔlaeA strains.

    • Expected outcome: Differences would suggest direct regulation of An01g07650 by LaeA-mediated epigenetic mechanisms.

This multifaceted approach addresses the complex nature of regulatory interactions in Aspergillus niger, with particular focus on the relationship between mitochondrial transport (An01g07650) and transcriptional regulation (LaeA) in controlling citric acid production and secondary metabolism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.