Recombinant Aspergillus oryzae Altered inheritance of mitochondria protein 31, mitochondrial (aim31)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aspergillus oryzae Aim31

The protein "Recombinant Aspergillus oryzae Altered inheritance of mitochondria protein 31, mitochondrial (Aim31)" refers to a specific protein produced through recombinant technology in the Aspergillus oryzae organism. Aim31 was initially discovered in a screen for genes that, when absent, resulted in altered mitochondrial DNA (mtDNA) inheritance . The function of Aim31 was initially unknown, but it has been found in association with the cytochrome bc1-COX supercomplex, where it binds to both the cytochrome bc1 and COX enzyme domains .

Role in Mitochondrial Function and Disease

Mitochondrial dysfunction is implicated in several diseases, including cancer, where altered dynamics of the cytoskeleton and one of its major structural components, β-actin, are observed . One study identifies AIM1 (absent in melanoma 1) as an actin-binding protein that suppresses pro-invasive properties in benign prostate epithelium .

Depletion of AIM1 in prostate epithelial cells increases cytoskeletal remodeling, intracellular traction forces, cell migration and invasion, and anchorage-independent growth. Decreased AIM1 expression results in increased metastatic dissemination in vivo . AIM1 strongly associates with the actin cytoskeleton in prostate epithelial cells in normal tissues, but not in prostate cancers . In invasive cancers, AIM1 is mislocalized from the actin cytoskeleton, and advanced prostate cancers often harbor AIM1 deletion and reduced expression . AIM1 is an important regulator of actin cytoskeletal dynamics, cell migration and invasion, and metastatic dissemination .

AIM1's Interaction with β-Actin

An unbiased proteomic interaction screen revealed 79 interacting proteins with AIM1, including components of the actin cytoskeleton, particularly β-actin, non-muscle myosin 9, and filamin A . Gene set enrichment analysis of the interacting proteins demonstrated a predominance of proteins involved in actin-based movement and cytoskeletal organization . AIM1 associates with endogenous β-actin in HEK293 cells . AIM1 co-precipitates with β-actin in RWPE-1 non-malignant prostate epithelial cells, further establishing that both proteins form a complex under physiological expression levels .

Impact on Cellular Biomechanical Properties

AIM1-depleted cells were larger in size and exercised greater traction (root mean square) averaged over the entire cell-projected area . All computed physical metrics of forces were significantly greater in AIM1-depleted cells than in AIM1-expressing cells . Overexpression of full-length AIM1, but not AIM1 Δ859 in AIM1-deficient cells, rescued the alterations in cell morphology and the cell’s contractile strength . AIM1 plays an important role in suppressing actin cytoskeletal remodeling dynamics and force-generating capacity .

Influence on Cell Motility and Invasion

AIM1 depletion significantly increased cell motility, with AIM1-depleted cells filling scratched wounds completely in 24 hours . A significant increase in cell invasion was noted in cells depleted of AIM1 by multiple sh-AIM1 constructs in prostate epithelial cells (RWPE-1, 957) as well as in prostate cancer cell lines (VCaP and PC3) . This phenotype was observed using different invasion matrix barriers (collagen, laminin, and matrigel), persisted after controlling for increased cell motility, and was reverted by overexpression of full-length AIM1 but not as much by expression of the actin-binding mutant AIM1 Δ859 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
rcf1; aim31; AO090023000757; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-176
Protein Length
full length protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
rcf1
Target Protein Sequence
MSSDPVPSSFEGNPQFEEETSLQKFRRRLKEEPLIPLGCAATSYALYRAYRSMKAGDSVE MNRMFRARIYAQFFTLIAVVVGGMYFKTERQQRKEFERMVEERKSQEKRDAWLRELEIRD KEDKDWRQRHAAMEAAAAEAGKKTAPHDAARSAIERSEEKSIGVLDAVKELLSRRN
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How conserved is aim31 across different Aspergillus species?

Sequence alignment analysis reveals high conservation of aim31 across Aspergillus species, with some characteristic variations. When comparing A. oryzae aim31 with A. clavatus aim31, we observe:

SpeciesSequence LengthSequence IdentityKey Variations
A. oryzae176 aaReferenceN/A
A. clavatus178 aa~93%Variations in N-terminal region and specific residues in the transmembrane domain
A. flavus176 aa~97%Minor substitutions in C-terminal region
A. terreus177 aa~88%Variations in central domain
A. fumigatus177 aa~90%Substitutions affecting membrane association

The high conservation suggests essential functions across fungal species, while variations may reflect species-specific adaptations .

What are the optimal expression systems for producing recombinant A. oryzae aim31?

The choice of expression system significantly impacts yield and functionality of recombinant aim31. Methodological approaches include:

E. coli Expression System:

  • Highest yield (typically 15-20 mg/L culture)

  • Fastest production timeline (2-3 days)

  • Lacks post-translational modifications

  • Typically requires His-tag for purification

  • Optimal induction: 0.5 mM IPTG at OD600 0.6-0.8, 18°C overnight

Yeast Expression System:

  • Moderate yield (5-10 mg/L)

  • Provides basic eukaryotic post-translational modifications

  • Better protein folding than E. coli

  • Expression in P. pastoris or S. cerevisiae recommended

  • Induction protocol: For P. pastoris, 0.5% methanol every 24h for 72-96h

Insect/Mammalian Cell Systems:

  • Lower yield but higher quality

  • Most complete post-translational modifications

  • Preserves native protein conformation

  • Extended production timeline (7-14 days)

For most basic research applications, E. coli expression is sufficient, while functional studies may benefit from eukaryotic expression systems that better maintain the protein's native conformation .

What purification strategies yield the highest purity and activity of recombinant aim31?

A systematic purification workflow is essential for obtaining high-quality aim31 protein:

  • Initial Capture: Immobilized metal affinity chromatography (IMAC) using His-tag

    • Buffer composition: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol

    • Imidazole gradient: 20-250 mM

    • Critical step: Include 0.1% mild detergent (DDM or CHAPS) to maintain solubility

  • Intermediate Purification: Ion exchange chromatography

    • Anion exchange using Q-Sepharose at pH 8.0

    • Salt gradient: 50-500 mM NaCl

  • Polishing Step: Size exclusion chromatography

    • Superdex 75 or 200 column

    • Buffer: 20 mM HEPES pH 7.5, 150 mM NaCl, 5% glycerol

  • Quality Control Assessment:

    • SDS-PAGE: >90% purity

    • Western blot: Confirmation using anti-His antibodies

    • Mass spectrometry: Verification of intact mass

The purified protein should be stored in buffer containing 50% glycerol at -20°C/-80°C with minimal freeze-thaw cycles to preserve activity .

How does aim31 affect mitochondrial dynamics and function in Aspergillus oryzae?

Research on aim31 and related proteins reveals its critical role in mitochondrial dynamics:

  • Respiratory Chain Function:

    • aim31 (rcf1) interacts with components of the electron transport chain

    • Deletion mutants show reduced cytochrome c oxidase activity

    • Mediates assembly of respiratory supercomplexes

  • Mitochondrial Membrane Organization:

    • Localizes to the inner mitochondrial membrane

    • Contributes to cristae structure maintenance

    • Interacts with other membrane proteins to regulate mitochondrial morphology

  • Impact on Mitochondrial Network:

    • Influences mitochondrial fusion and fission processes

    • Related to proteins like Fzo1 (mitofusin homolog) in maintaining network integrity

    • Disruption of aim31 can lead to mitochondrial fragmentation

  • Metabolic Consequences:

    • Affects oxidative phosphorylation efficiency

    • Influences adaptation to different carbon sources

    • May play role in stress response pathways

These functions make aim31 an important target for studying mitochondrial homeostasis in filamentous fungi .

How can aim31 be used as a tool in paratransgenesis approaches for controlling fungal pathogens?

Aim31 and related mitochondrial proteins offer promising applications in paratransgenesis-based control strategies:

Conceptual Framework:
Similar to approaches used with A. oryzae-R (recombinant) in controlling malaria parasites in mosquitoes, aim31 could be engineered as part of fungal control strategies. The protein could be modified to express anti-pathogenic peptides that disrupt target organisms.

Methodology Development:

  • Vector Design: Create recombinant constructs expressing modified aim31 fused with effector peptides

  • Delivery System: Develop fungal strains that can be transmitted to target pathogens

  • Target Specificity: Engineer specificity to minimize ecological impact

  • Persistence Mechanism: Ensure sustained expression through appropriate promoters

Potential Applications:

  • Control of agricultural fungal pathogens

  • Targeting human pathogenic fungi

  • Ecological control of invasive fungal species

This approach is supported by research showing that recombinant A. oryzae strains modified to secrete anti-plasmodial effector peptides successfully inhibited parasite development in mosquitoes .

How do mutations in aim31 affect mitochondrial inheritance and fungal virulence?

Advanced genetic analysis reveals complex relationships between aim31 mutations and phenotypic outcomes:

Mitochondrial Inheritance Patterns:
Mutations in aim31 can disrupt normal mitochondrial inheritance through several mechanisms:

  • Altered mitochondrial-ER contacts via ERMES complex interaction

  • Disruption of mitochondrial DNA segregation during cell division

  • Impaired mitochondrial transport and positioning

Impact on Virulence Factors:
In pathogenic fungi, mitochondrial proteins like aim31 influence virulence through:

  • Metabolic Adaptation: Compromised ability to utilize host carbon sources

  • Stress Response: Reduced tolerance to oxidative and nitrosative stress

  • Morphogenetic Transitions: Impaired hyphal development and invasion

  • Drug Susceptibility: Altered response to antifungal compounds

Experimental Evidence:
Studies in Candida albicans show that disruption of mitochondrial fusion via Fzo1 deletion (which interacts with the aim31 pathway) resulted in:

  • Drastic fitness impairment

  • Perturbed mitochondrial phospholipid levels

  • Increased susceptibility to azole antifungals

  • Mitochondrial DNA loss

These findings suggest aim31 represents a potential target for antifungal strategies that could exploit fungal-specific mitochondrial pathways .

What are the structural determinants of aim31 function and how do they differ from mammalian homologs?

Structural analysis of aim31 reveals key features that distinguish fungal mitochondrial proteins from their mammalian counterparts:

Domain Architecture:

  • N-terminal region: Mitochondrial targeting sequence

  • Central domain: Contains conserved CXXXC motif important for function

  • C-terminal region: Membrane-association domain

Structural Elements Critical for Function:

  • Transmembrane Helices: Contains predicted transmembrane domains that anchor the protein to the inner mitochondrial membrane

  • Interaction Interface: Specific residues mediate protein-protein interactions with respiratory complexes

  • Lipid-Binding Domain: Regions that interact with cardiolipin and other mitochondrial phospholipids

Comparative Analysis with Mammalian Systems:
Fungal aim31 proteins differ significantly from their functional homologs in metazoans (metaxins):

  • Different primary sequence with <25% identity

  • Distinct structural organization

  • Unique interaction partners

  • Different membrane topology

These structural differences make aim31 a potential target for fungal-specific inhibitors that would not affect mammalian mitochondrial function .

How can contradictions in experimental data on aim31 function be reconciled?

Researchers frequently encounter seemingly contradictory results when studying aim31. Methodological approaches to reconcile these discrepancies include:

Systematic Analysis Framework:

  • Context-Dependent Function Assessment:

    • Evaluate experimental conditions (carbon source, oxygen availability, growth phase)

    • Consider genetic background differences between strains

    • Assess compensatory mechanisms activated in chronic vs. acute disruption

  • Multi-Parameter Measurement:

    • Combine biochemical, genetic, and imaging approaches

    • Measure dynamic responses rather than end-point measurements

    • Correlate in vitro and in vivo observations

  • Statistical Reconciliation Methods:

    • Apply information-theoretic model comparison (as used in other biological systems)

    • Normalize data using probabilistic frameworks

    • Identify monotonic relationships between different metrics

Example Reconciliation:
When measuring aim31 function using different assays (respiration rate, growth phenotype, protein interaction), contradictions often arise. These can be resolved by considering factors such as:

  • Measurement timing relative to mitochondrial biogenesis cycles

  • Secondary effects of chronic protein depletion

  • Differences in model systems (from in vitro to complex organisms)

This approach aligns with information-theoretic methods successfully used to reconcile contradictions in other biological data sets .

What are the methodological challenges in studying aim31 interactions with respiratory supercomplexes?

Advanced research on aim31 function faces specific technical challenges:

Critical Technical Limitations:

  • Membrane Protein Solubilization:

    • Challenge: Maintaining native conformation during extraction

    • Solution: Optimize detergent type and concentration; consider nanodisc reconstitution

    • Validation: Functional assays confirming protein activity post-solubilization

  • Dynamic Interaction Capture:

    • Challenge: aim31 interactions may be transient or condition-dependent

    • Solution: Implement crosslinking approaches (photo-activatable or chemical)

    • Analysis: Mass spectrometry with quantitative interaction profiling

  • Functional Reconstitution:

    • Challenge: Validating interactions in minimal systems

    • Approach: Liposome reconstitution with defined components

    • Measurement: Membrane potential or electron transfer assays

  • Resolution Limitations:

    • Challenge: Supercomplex structures are difficult to resolve at high resolution

    • Solution: Combine cryo-EM with cross-linking mass spectrometry

    • Analysis: Integrative structural modeling

Experimental Workflow Optimization:
For researchers facing these challenges, a recommended workflow involves:

  • Stabilize interactions using mild solubilization and GraFix approach

  • Validate interactions using complementary methods (co-IP, BN-PAGE, FRET)

  • Confirm functionality through in vitro activity assays

  • Correlate structural data with functional outcomes

These approaches can help overcome limitations inherent in studying dynamic membrane protein complexes like those involving aim31 .

How can recombinant A. oryzae aim31 be utilized in genetic engineering approaches for improved industrial applications?

Building on recent advances in A. oryzae engineering, aim31 offers novel opportunities for industrial strain enhancement:

Potential Engineering Approaches:

  • Metabolic Engineering Strategy:

    • Overexpression of engineered aim31 to enhance mitochondrial function

    • Co-expression with other respiratory components to optimize energy production

    • Fine-tuning of expression levels using controlled promoters

  • Strain Development Methodology:

    • Integration of modified aim31 into industrial production strains

    • Combination with cell wall modifications (AGΔ-GAGΔ) for improved culture characteristics

    • Selection of optimal transformants based on mitochondrial function metrics

Anticipated Outcomes:

  • Enhanced respiratory capacity and energy generation

  • Improved growth characteristics in industrial fermentation

  • Increased resistance to fermentation stress conditions

  • Better production of heterologous proteins

Research on A. oryzae mutants lacking α-1,3-glucan and GAG has already demonstrated improved recombinant protein production through enhanced culture rheology. Combining these approaches with aim31 engineering could further optimize industrial production strains .

What is the relationship between aim31 and mitochondrial DNA maintenance in filamentous fungi?

Recent research suggests important connections between aim31 and mitochondrial genome stability:

Mechanistic Relationships:

  • Intron Dynamics and aim31 Function:

    • Fungal mitochondrial genomes contain variable numbers of introns

    • Group I and II introns with homing endonuclease genes (HEGs) may affect genome stability

    • aim31 may influence intron mobility and mitochondrial DNA organization

  • Mitochondrial Nucleoid Association:

    • aim31 potentially interacts with nucleoid proteins

    • May affect mtDNA replication and segregation

    • Could influence heteroplasmy resolution

Research Implications:
Studying these relationships requires sophisticated methodologies:

  • Long-read sequencing of mitochondrial genomes

  • Chromatin immunoprecipitation to identify protein-DNA interactions

  • Live-cell imaging of nucleoid dynamics in aim31 mutants

  • Heteroplasmy stability assays in genetically modified strains

Understanding these relationships could provide insights into both fundamental mitochondrial biology and fungal evolution, as intron content and organization vary dramatically across fungal species, from 0 introns in Metarhizium anisopliae to 35 introns comprising 54% of the mitochondrial genome in Fusarium graminearum .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.