Recombinant Aspergillus oryzae Bifunctional lycopene cyclase/phytoene synthase (AO090020000159)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference when placing the order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped standard with normal blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
AO090020000159; Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase; Lycopene cyclase; Phytoene synthase; ]
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-587
Protein Length
full length protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
AO090020000159
Target Protein Sequence
MGLDYILVHVTYNIPLAGILTLVYWPFMTRLDWQKISTLVIISLVATIPWDSYLVRHRIW TYAPNGVIGWTLYDIPSEEVFFFIIQTYNTSLVYLILTRWLVLPMYLGTVARKETLIGAS ILLLAISVGLIALCFGDHFTYFGMIITWAGPFLLIQWVFSSGFIIALPKLELMVSITLPT LFLWTVDTISINQGTWTVEAPTKLGVQLWSGMDIEEVLFFLITNIVIVFGLVCIDYAIAM ATCELVQSPQAVQSFPSYFRVLARFVTNKYHPDKQFVASLRKAVDRLAASSQSMYMGSAM FQGPFRIDLILLYSFFRVADDLVDESQDTESARMIIEQCDQLLEAKFSHPELFPFSPGYQ EAKHPAPPELIAAIDSLPVSRLRLEHLKGLIEGFRTDLTFSAKPGSFPFVTESDLDTYAY HVASSVAASMLGLVVHHFPDHQFAINVFLRRRVVDAGERMGQTLQYINVARDIARDAAIN RVYLPTTWLKQQGLGPEDVLASPTDSRLELVRDRLLDRAEFLSASAREEMKFLPDEVQGP FLATVDSYLEIGAALRRGMRPRTLDDKLRLPLGTRLWVAYRAMAWRK
Uniprot No.

Target Background

Function
This bifunctional enzyme catalyzes the reactions converting geranylgeranyl diphosphate to phytoene (phytoene synthase) and lycopene to beta-carotene via the intermediate gamma-carotene (lycopene cyclase).
Database Links
Protein Families
Lycopene beta-cyclase family; Phytoene/squalene synthase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Why is Aspergillus oryzae significant as a research organism in biotechnology?

Aspergillus oryzae holds exceptional significance in biotechnology research for several key reasons:

First, A. oryzae possesses a prestigious secretory system that enables high-concentration protein secretion into its culturing medium, making it an ideal platform for heterologous protein expression . This characteristic has positioned the organism as a powerful biotechnological tool across multiple disciplines including veterinary medicine, food science, pharmaceutical development, and industrial applications.

Second, the genomic structure of A. oryzae reveals evolutionary adaptations that support its biotechnological utility. The organism's genome (37.6 Mb distributed across eight chromosomes) is 25-30% larger than related Aspergilli species, containing 2,000-3,000 additional genes . This expanded genetic repertoire, particularly in secondary metabolism pathways, contributes to A. oryzae's rich metabolic diversity.

Third, A. oryzae has undergone domestication through centuries of use in traditional fermentation processes, particularly in Japanese cuisine (koji mold). This extensive history of safe use provides researchers with a well-characterized organism that has likely been selected for traits favorable to human applications .

For researchers investigating carotenoid biosynthesis specifically, the bifunctional nature of AO090020000159 presents a unique opportunity to study enzyme evolution and functional integration in secondary metabolite pathways.

How does the canonical structure of AO090020000159 compare with related enzymes in other organisms?

The bifunctional nature of AO090020000159 represents an interesting case of protein evolution. Unlike many organisms that possess separate enzymes for lycopene cyclase and phytoene synthase activities, A. oryzae employs a fusion protein that combines both functions.

Comparative structural analysis reveals:

This bifunctional arrangement contrasts with many plants and bacteria that utilize separate enzymes in the carotenoid biosynthetic pathway, highlighting the diverse evolutionary solutions to similar metabolic challenges.

What are the optimal conditions for expressing recombinant AO090020000159 in E. coli?

Successful expression of Recombinant A. oryzae Bifunctional lycopene cyclase/phytoene synthase requires careful optimization of experimental conditions:

Expression System Parameters:

  • Host Strain: BL21(DE3) or Rosetta(DE3) strains are recommended for efficient expression of fungal proteins with potentially rare codons

  • Vector Selection: pET series vectors with T7 promoter systems offer strong induction control

  • Temperature: Lowering induction temperature to 18-20°C improves protein folding and solubility

  • Induction: 0.1-0.5 mM IPTG at OD600 of 0.6-0.8 typically yields optimal balance between expression and solubility

Critical Optimization Factors:

  • Codon Optimization: The A. oryzae gene sequence should be optimized for E. coli codon usage to enhance translation efficiency

  • Solubility Enhancement: Fusion partners such as SUMO, MBP, or TrxA may improve solubility beyond the standard His-tag

  • Media Composition: Auto-induction media can provide higher yields than traditional IPTG induction in LB media

  • Cell Lysis: Sonication in buffer containing 50 mM Tris-HCl (pH 8.0), 300 mM NaCl, 10% glycerol, and 1 mM PMSF optimizes protein recovery

Expression success can be confirmed via SDS-PAGE analysis, where the target protein should appear with >90% purity following appropriate purification steps .

What are the recommended storage and handling protocols for maintaining AO090020000159 stability?

Maintaining stability of recombinant AO090020000159 requires attention to specific storage and handling protocols:

Short-term Storage (1-2 weeks):

  • Store at 4°C in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose

  • Avoid repeated freeze-thaw cycles as they significantly reduce enzymatic activity

  • Working aliquots should be maintained at 4°C for no more than one week

Long-term Storage:

  • Store at -20°C or preferably -80°C in small aliquots

  • Add glycerol to a final concentration of 20-50% (50% recommended) to prevent freeze-thaw damage

  • Lyophilized powder formulations offer maximum stability when stored at -20°C/-80°C

Reconstitution Protocol:

  • Centrifuge vial briefly before opening to collect content at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to 50% final concentration for aliquoting and long-term storage

  • Document reconstitution date and storage conditions in laboratory records

Activity Preservation:

  • Presence of reducing agents (0.1-1 mM DTT or 2-5 mM β-mercaptoethanol) helps maintain cysteine residues in reduced state

  • Addition of metal chelators (1 mM EDTA) prevents metal-catalyzed oxidation

  • pH stability is optimal between 7.5-8.5

Researchers should validate protein stability through activity assays after different storage durations to establish maximum storage periods for their specific experimental conditions.

What purification strategies yield the highest purity and activity for recombinant AO090020000159?

Purification of His-tagged recombinant AO090020000159 requires a multi-step approach to achieve optimal purity while preserving enzymatic activity:

Immobilized Metal Affinity Chromatography (IMAC) - Primary Purification:

  • Equilibrate Ni-NTA resin with binding buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole)

  • Apply cleared lysate to the column and wash extensively with binding buffer

  • Remove weakly bound contaminants with washing buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 20-30 mM imidazole)

  • Elute target protein with elution buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 250-300 mM imidazole)

  • Analyze fractions by SDS-PAGE to identify target protein-containing fractions

Secondary Purification Options:

  • Size Exclusion Chromatography: Separates monomeric protein from aggregates and further removes impurities

  • Ion Exchange Chromatography: Particularly Q-Sepharose at pH 8.0 can provide additional purification based on the protein's charge properties

Purity Assessment:

  • SDS-PAGE analysis should confirm >90% purity

  • Western blot using anti-His antibodies can verify target protein identity

  • Mass spectrometry can confirm protein integrity and exact molecular weight

Activity Preservation During Purification:

  • Maintain all buffers and procedures at 4°C

  • Include protease inhibitors (PMSF, EDTA, or commercial cocktails) in initial lysis buffers

  • Consider adding stabilizing agents (5-10% glycerol, 1 mM DTT) to all purification buffers

  • Minimize time between purification steps

For highest purity preparations intended for crystallography or other sensitive applications, consider removal of the His-tag using appropriate proteases (TEV or thrombin) followed by reverse IMAC and final polishing with size exclusion chromatography.

How does the bifunctional nature of AO090020000159 affect its catalytic mechanisms compared to monofunctional homologs?

The bifunctional architecture of AO090020000159 presents several mechanistic implications that distinguish it from organisms employing separate lycopene cyclase and phytoene synthase enzymes:

Catalytic Efficiency Considerations:

  • Substrate Channeling Effect:

    • The physical proximity of the two catalytic domains likely facilitates direct transfer of intermediates between active sites

    • This arrangement potentially reduces loss of unstable intermediates to competing reactions

    • Estimated efficiency increase of 20-30% compared to separate enzymes based on similar bifunctional systems

  • Conformational Dynamics:

    • The dual catalytic domains likely undergo coordinated conformational changes during catalysis

    • Domain interactions may provide allosteric regulation between the two enzymatic activities

    • Spectroscopic studies of similar bifunctional enzymes suggest that substrate binding to one domain can influence activity of the second domain

  • Evolutionary Adaptation:

    • The fusion of these two enzymes in A. oryzae likely represents an evolutionary adaptation to optimize carotenoid biosynthesis

    • This arrangement aligns with A. oryzae's expanded secondary metabolism capabilities compared to related Aspergilli species

Regulatory Implications:
The bifunctional arrangement potentially places both enzymatic activities under common transcriptional and post-translational regulation, which may allow for more coordinated control of the carotenoid biosynthetic pathway in response to environmental signals.

Understanding these catalytic mechanisms requires advanced enzyme kinetics studies comparing the bifunctional enzyme to individual domains expressed separately, as well as to monofunctional homologs from other organisms.

What analytical methods are most effective for characterizing the enzymatic activities of AO090020000159?

Comprehensive characterization of AO090020000159's dual enzymatic activities requires sophisticated analytical approaches:

Spectrophotometric Assays:

  • Phytoene Synthase Activity:

    • Measure conversion of geranylgeranyl diphosphate (GGPP) to phytoene

    • Monitor decrease in GGPP concentration using coupled enzyme assays

    • Alternatively, quantify phytoene production by absorbance at 286 nm

    • Reaction conditions: 100 mM Tris-HCl (pH 7.5), 5 mM MgCl₂, 1 mM DTT, 100 μM GGPP, 37°C

  • Lycopene Cyclase Activity:

    • Measure conversion of lycopene to β-carotene

    • Monitor decrease in lycopene (absorbance at 470 nm) and increase in β-carotene (absorbance at 450 nm)

    • Reaction conditions: 100 mM HEPES (pH 8.0), 0.1% Triton X-100, 5 mM sodium ascorbate, 50 μM lycopene, 30°C

Chromatographic Methods:

  • HPLC Analysis:

    • Reverse-phase HPLC with C18 or C30 columns

    • Mobile phase: Acetonitrile/methanol/2-propanol (85:10:5)

    • Detection: UV-Vis diode array detector monitoring 280-550 nm

    • This method allows quantification of both substrates and products

  • LC-MS/MS:

    • Provides structural confirmation of enzyme products

    • Enables detection of unexpected intermediate compounds

    • Can detect trace amounts of products in complex mixtures

Steady-State Kinetics:

  • Determine Km, kcat, and kcat/Km for both enzymatic activities

  • Investigate potential cooperative effects between the two catalytic functions

  • Compare kinetic parameters with those of monofunctional enzymes

Isothermal Titration Calorimetry:

  • Measure thermodynamic parameters of substrate binding

  • Determine binding affinities and stoichiometry

  • Assess potential allosteric interactions between domains

These analytical approaches should be combined with site-directed mutagenesis of key catalytic residues to establish structure-function relationships that explain the bifunctional nature of this enzyme.

How has the genome expansion of A. oryzae influenced the evolution of AO090020000159 and related secondary metabolism pathways?

The genomic context of AO090020000159 provides critical insights into its evolutionary history and functional significance within A. oryzae's metabolic network:

Genomic Context and Evolution:

  • Expanded Secondary Metabolism Gene Clusters:

    • A. oryzae possesses a 25-30% larger genome (37.6 Mb) than related Aspergilli species

    • This expansion includes 2,000-3,000 additional genes, with secondary metabolism genes showing particularly prominent expansion

    • AO090020000159 likely emerged through either gene duplication followed by fusion or horizontal gene transfer events

  • Non-Syntenic Blocks Analysis:

    • Many secondary metabolism genes in A. oryzae reside in non-syntenic blocks compared to related species

    • These blocks represent regions that have undergone significant evolutionary diversification

    • Approximately 40% of A. oryzae genes show no synteny with related Aspergilli, indicating substantial genomic reorganization

  • Domestication Influence:

    • The centuries-long domestication of A. oryzae in food fermentation has likely selected for specific metabolic capabilities

    • Comparative genomics suggests selection processes have favored certain secondary metabolism pathways while eliminating others potentially harmful for human consumption

Functional Implications:

  • Metabolic Network Integration:

    • The bifunctional enzyme represents efficient pathway integration within carotenoid biosynthesis

    • This integration likely contributes to A. oryzae's robust secondary metabolism capacity

    • The coordinated regulation of the fused enzyme may provide adaptive advantages in responding to environmental conditions

  • Domestication Signatures:

    • Analysis of gene clusters surrounding AO090020000159 may reveal selection signatures from domestication

    • Similar to the situation with aflatoxin biosynthesis genes, which are present but not expressed in A. oryzae

    • Understanding these evolutionary patterns can inform synthetic biology approaches for metabolic engineering

This evolutionary context emphasizes the importance of considering both functional and genomic perspectives when studying AO090020000159, and highlights its value as a model for understanding enzyme fusion events in secondary metabolism.

What strategies can address low expression yield or insolubility problems with recombinant AO090020000159?

When encountering expression challenges with recombinant AO090020000159, researchers should consider the following systematic troubleshooting approaches:

Addressing Insolubility Issues:

ApproachImplementation StrategyExpected Outcome
Expression Temperature ModulationReduce induction temperature to 16-18°CSlower expression allows proper folding
Solubility TagsSwitch from His-tag to larger fusion partners (MBP, SUMO, TrxA)Enhanced solubility through chaperone-like effects
Co-expression with ChaperonesCo-transform with plasmids encoding GroEL/GroES or DnaK/DnaJ/GrpEAssisted protein folding during expression
Lysis Buffer OptimizationInclude mild detergents (0.1% Triton X-100) or higher salt (300-500 mM NaCl)Reduced aggregation during cell lysis
Refolding ProtocolsPurify under denaturing conditions followed by stepwise dialysisRecovery of properly folded protein from inclusion bodies

Improving Expression Yield:

  • Codon Optimization Analysis:

    • Analyze the gene sequence for rare codons in E. coli

    • Consider using Rosetta strains with additional tRNAs for rare codons

    • Alternatively, synthesize a fully codon-optimized gene version

  • Promoter and Vector Selection:

    • Test alternative promoter systems (tac, T5) if T7 system yields are low

    • Compare expression levels in different vector backbones

    • Consider dual-plasmid systems if toxicity is suspected

  • Media and Growth Conditions:

    • Test enriched media formulations (Terrific Broth, Super Broth)

    • Implement auto-induction systems for gradual protein expression

    • Optimize cell density at induction time (typically OD600 0.6-0.8)

  • Post-expression Analysis:

    • Perform time-course analysis of expression to determine optimal harvest time

    • Assess protein integrity via western blotting to identify potential degradation

    • Confirm mRNA production via RT-PCR if protein expression is undetectable

When conventional approaches fail, consider alternative expression systems such as Pichia pastoris or baculovirus-infected insect cells, which may provide a more suitable environment for proper folding of this fungal protein.

How can researchers validate the integrity and functionality of purified AO090020000159?

Comprehensive validation of recombinant AO090020000159 requires a multi-faceted approach to confirm both structural integrity and enzymatic functionality:

Structural Integrity Assessment:

  • SDS-PAGE and Western Blotting:

    • Confirm expected molecular weight (~65-70 kDa including His-tag)

    • Verify protein identity via Western blot using anti-His antibodies

    • Check for degradation products or truncated forms

  • Mass Spectrometry Analysis:

    • Peptide mass fingerprinting following tryptic digestion

    • Intact protein mass determination to confirm full-length expression

    • Sequence coverage analysis to identify potential post-translational modifications

  • Circular Dichroism (CD) Spectroscopy:

    • Assess secondary structure composition

    • Compare with predicted structural elements based on sequence analysis

    • Thermal stability profiling to determine melting temperature

Functional Validation:

  • Enzyme Activity Assays:

    • Phytoene synthase activity: Measure conversion of GGPP to phytoene

    • Lycopene cyclase activity: Measure conversion of lycopene to β-carotene

    • Compare specific activities with literature values for similar enzymes

  • Substrate Binding Analysis:

    • Surface plasmon resonance (SPR) to measure binding kinetics

    • Fluorescence quenching studies to assess substrate interactions

    • Isothermal titration calorimetry (ITC) for thermodynamic binding parameters

  • Complementation Studies:

    • Express AO090020000159 in carotenoid biosynthesis pathway mutants

    • Assess rescue of phenotype in organisms deficient in either enzyme activity

    • Similar to the approach used for α-isopropylmalate synthase in S. pombe

Critical Quality Attributes Table:

ParameterMethodAcceptance Criteria
PuritySDS-PAGE>90% purity
IdentityWestern Blot, MSConfirms expected MW and sequence
Phytoene Synthase ActivityGGPP consumption assay>70% activity compared to reference
Lycopene Cyclase ActivityLycopene consumption assay>70% activity compared to reference
Thermal StabilityDifferential Scanning FluorimetryTm >45°C
AggregationSize Exclusion Chromatography>90% monomeric form

This comprehensive validation ensures that experimental results obtained with the recombinant protein accurately reflect the native enzyme's properties.

What are the most common methodological challenges in studying bifunctional enzymes like AO090020000159 and how can they be addressed?

Investigating bifunctional enzymes presents unique methodological challenges that require specialized approaches:

Challenge 1: Distinguishing Individual Catalytic Activities

Problem: Traditional enzyme assays may not differentiate between the two catalytic functions, especially if they share substrates or cofactors.

Solution:

  • Design domain-specific inhibitors to selectively block one activity

  • Create domain-inactivating mutations through site-directed mutagenesis

  • Develop coupled enzyme assays that specifically detect products from each domain

  • Employ isotope-labeled substrates with mass spectrometry detection to track activity-specific products

Challenge 2: Structural Characterization of Large, Multi-domain Proteins

Problem: The size and complexity of bifunctional enzymes often complicate structural studies.

Solution:

Challenge 3: Analyzing Domain Communication and Substrate Channeling

Problem: Interaction between domains and potential substrate channeling are difficult to detect experimentally.

Solution:

  • Implement stopped-flow kinetics to detect transient intermediates

  • Utilize molecular dynamics simulations to model substrate transfer between active sites

  • Employ chemical cross-linking coupled with mass spectrometry to identify domain interfaces

  • Design inter-domain linker mutations to assess effects on coupled activities

Challenge 4: Heterologous Expression of Complete Bifunctional Enzymes

Problem: Full-length expression often results in lower yields and solubility issues compared to individual domains.

Solution:

  • Implement A. oryzae's powerful secretory system for homologous expression

  • Test expression in fungal hosts phylogenetically related to A. oryzae

  • Optimize domain boundaries and linker regions when expressing individual domains

  • Consider cell-free protein synthesis systems for difficult-to-express constructs

Challenge 5: Designing Appropriate Controls for Kinetic Studies

Problem: The bifunctional nature complicates interpretation of kinetic data and mechanism studies.

Solution:

  • Express and characterize individual domains as separate proteins

  • Compare with naturally occurring monofunctional homologs from other organisms

  • Design experiments that can distinguish sequential from concurrent catalysis

  • Employ global kinetic modeling approaches that account for multiple catalytic events

By anticipating and addressing these methodological challenges, researchers can develop more robust experimental designs for investigating the unique properties of bifunctional enzymes like AO090020000159.

How might AO090020000159 be utilized for synthetic biology applications in metabolic engineering?

The bifunctional nature of AO090020000159 presents exciting opportunities for synthetic biology applications, particularly in reconstructing and optimizing carotenoid biosynthetic pathways:

Pathway Engineering Applications:

  • Streamlined Carotenoid Production:

    • The bifunctional enzyme reduces the number of genes needed for heterologous pathway reconstruction

    • This simplification can decrease metabolic burden in engineered organisms

    • Potential applications include production of high-value carotenoids like astaxanthin or zeaxanthin

  • Substrate Channeling Exploitation:

    • The natural fusion of two sequential enzymes may improve pathway flux by reducing intermediate loss

    • Researchers can use this model to design synthetic fusion proteins for other metabolic pathways

    • Similar fusion strategies might be applied to other secondary metabolite pathways with labile intermediates

  • Aspergillus oryzae as a Heterologous Expression Platform:

    • A. oryzae's robust secretory system makes it an excellent candidate for heterologous protein production

    • The genomic context of AO090020000159 could reveal optimal promoters and regulatory elements for controlled expression

    • A. oryzae's GRAS (Generally Recognized As Safe) status facilitates regulatory approval for biotechnology applications

Methodological Considerations for Pathway Engineering:

  • Modular Cloning Strategies:

    • Golden Gate or Gibson Assembly methods for rapid pathway construction

    • Standardized parts libraries incorporating AO090020000159 and related enzymes

    • Combinatorial assembly approaches to optimize gene arrangement and expression levels

  • Expression Optimization:

    • Promoter engineering to control expression timing and level

    • Codon optimization for different host organisms

    • Investigation of transcriptional terminators and mRNA stability elements

  • Metabolic Burden Mitigation:

    • Balancing expression levels to minimize resource competition

    • Dynamic regulation systems responsive to metabolic state

    • Compartmentalization strategies to concentrate pathway components

The long history of domestication and industrial use of A. oryzae provides valuable insights for these applications, as traditional fermentation processes have already selected for strains with advantageous characteristics for biotechnological applications .

What emerging analytical techniques might provide new insights into the structure-function relationship of AO090020000159?

Cutting-edge analytical technologies offer promising approaches to elucidate the complex structure-function relationships in bifunctional enzymes like AO090020000159:

Advanced Structural Biology Techniques:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Single-particle analysis capable of near-atomic resolution

    • Visualization of multiple conformational states without crystallization

    • Particularly valuable for capturing domain movements during catalysis

  • Integrative Structural Biology:

    • Combining X-ray crystallography, NMR, SAXS, and computational modeling

    • Provides comprehensive understanding of both structure and dynamics

    • Reveals domain interactions and potential substrate channeling pathways

  • Time-resolved X-ray Crystallography:

    • Captures structural snapshots during the catalytic cycle

    • Reveals transient intermediate states

    • Elucidates conformational changes associated with each catalytic activity

Dynamic Analysis Methods:

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps protein dynamics and solvent accessibility changes upon substrate binding

    • Identifies regions involved in allosteric communication between domains

    • Provides insights into conformational flexibility without size limitations

  • Single-Molecule Förster Resonance Energy Transfer (smFRET):

    • Monitors distance changes between strategically placed fluorophores

    • Reveals conformational dynamics in real-time

    • Capable of detecting rare or transient states missed by ensemble methods

  • Native Mass Spectrometry:

    • Analyzes intact protein complexes and ligand binding

    • Detects post-translational modifications and their impact on function

    • Provides stoichiometry information for multi-protein complexes

Computational Approaches:

  • Molecular Dynamics Simulations:

    • Models protein dynamics at atomic resolution

    • Simulates substrate binding and catalytic mechanisms

    • Predicts potential substrate channeling pathways between active sites

  • Quantum Mechanics/Molecular Mechanics (QM/MM):

    • Models electronic structure of active sites during catalysis

    • Calculates transition state energetics

    • Provides mechanistic insights at the electronic level

  • Machine Learning Applied to Protein Function:

    • Analyzes sequence-structure-function relationships across homologs

    • Predicts functional sites and substrate specificities

    • Guides rational design of improved variants

Implementation of these advanced techniques will require interdisciplinary collaboration but offers the potential to fully elucidate how the bifunctional nature of AO090020000159 contributes to its unique catalytic properties and evolutionary advantages.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.