Recombinant Aspergillus oryzae Chitin synthase export chaperone (chs7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributor for specific delivery time information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is dependent on various factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
chs7; AO090001000344; Chitin synthase export chaperone
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
chs7
Target Protein Sequence
MGFGDFDTICQKAALPLCSLVGPASSISGATGIIPNCYARNIELANTIIFEGAASFVHII ALAMTVIMILHIRSKFTAVGRKEIITFFYIYMLLTMCSLVIDAGVVPPRSGPFPYFVAVQ NGLTSALCTSLLVNGFVGFQLYEDGTALSVWLLRLTSTAMFAISFVISLLTFKSWGGLSP TNTVGMFVVLYILNAICIAVYLIMQLLLVMNTLEDRWPLGHIAFGLLVFICGQVLLYAFS DTICENVQHYLDGLFFTTICNLLAVMMVYKFWDYITKEDLEFSVGIKPNTWEVKEFLPEE DRRATVYQDTNSEYAGSMYHHRASAYNNHNY
Uniprot No.

Target Background

Function
This chaperone is essential for the export of the chitin synthase chs3 from the endoplasmic reticulum.
Database Links
Protein Families
CHS7 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of chitin synthase export chaperone (CHS7) in Aspergillus species?

CHS7 functions as an essential export chaperone for chitin synthases, facilitating their proper localization and function. In Aspergillus species, CHS7 is particularly important for hyphal growth, conidiogenesis (asexual spore formation), and cell wall integrity . Unlike other chitin synthase genes, CHS7 plays a unique role in specialized fungal structures and development processes. Comparative analyses across fungal species have demonstrated that CHS7 is highly conserved, emphasizing its fundamental importance in fungal biology .

How does CHS7 expression vary during different developmental stages in Aspergillus species?

Transcriptomic analyses have revealed that CHS7 is differentially expressed throughout the fungal life cycle, with significantly higher expression in conidia compared to vegetative hyphae . The gene is particularly upregulated during the final stages of asexual development, consistent with its role in conidial formation and maturation. In Aspergillus species including A. nidulans, A. flavus, and A. fumigatus, CHS7 expression follows similar patterns, being part of the conserved chitin biogenesis gene cluster that is predominantly active during conidiogenesis .

What is known about the functional domains and structure of CHS7 protein in Aspergillus oryzae?

CHS7 in Aspergillus oryzae contains multiple transmembrane (TM) domains characteristic of the chitin synthase family . While not a chitin synthase itself, CHS7 functions as an export chaperone that facilitates the proper folding, trafficking, and localization of chitin synthases through the secretory pathway. The protein lacks catalytic domains found in chitin synthases but contains structural elements necessary for protein-protein interactions and membrane association. These structural features are conserved across Aspergillus species, reflecting the important chaperoning function of CHS7 .

What are the recommended approaches for generating recombinant Aspergillus oryzae strains expressing modified CHS7?

To generate recombinant A. oryzae strains with modified CHS7, researchers should consider the following methodological approach:

  • Gene targeting strategy: Utilize the β-rec/six system for precise gene deletion and modification, as this allows for multiple genetic manipulations in the same strain .

  • Promoter selection: For overexpression studies, employ either the constitutive gpdA (glyceraldehyde-3-phosphate dehydrogenase) promoter or an inducible promoter system like the alcohol-inducible alcA promoter.

  • Transformation protocol:

    • Prepare protoplasts using lysing enzymes in an osmotic stabilizer

    • Transform with the linearized construct containing CHS7 with appropriate selection markers

    • Screen transformants on selection media

    • Verify integration by PCR and Southern blot analysis

  • Expression verification: Confirm successful expression using RT-qPCR and Western blot analysis with specific antibodies against CHS7 or added epitope tags .

This approach has been successfully used with other Aspergillus species and can be adapted for A. oryzae CHS7 studies .

How should researchers design experiments to assess the phenotypic effects of CHS7 deletion or modification?

A comprehensive experimental design to assess CHS7 function should include the following components:

  • Growth analysis:

    • Measure radial growth on various media (complete, minimal, stress-inducing)

    • Quantify biomass accumulation in liquid culture

    • Assess colony morphology under different environmental conditions

  • Developmental phenotyping:

    • Quantify conidiation (asexual sporulation) rates

    • Examine conidiophore structure using microscopy

    • Analyze timing of developmental progression

  • Cell wall characterization:

    • Measure chitin content in vegetative hyphae and conidia using the glucosamine hydrochloride assay

    • Quantify chitin synthase enzymatic activity in microsomal fractions

    • Assess susceptibility to cell wall-disrupting agents (Calcofluor White, Congo Red)

  • Stress tolerance assessment:

    • Test thermal stress resistance (both high and low temperatures)

    • Evaluate oxidative stress tolerance (H₂O₂, menadione)

    • Measure osmotic stress resistance (NaCl, sorbitol)

  • Microscopic analysis:

    • Examine hyphal morphology and septal formation

    • Visualize chitin distribution using fluorescent probes (Calcofluor White)

    • Monitor subcellular localization of chitin synthases using fluorescent protein fusions

This comprehensive approach allows for thorough characterization of CHS7 function in fungal development and cell wall formation.

What methods are recommended for measuring chitin synthase activity in recombinant A. oryzae strains?

The following protocol is recommended for measuring chitin synthase activity in recombinant A. oryzae strains:

  • Preparation of microsomal fraction:

    • Harvest fungal tissue and homogenize in buffer containing protease inhibitors

    • Perform differential centrifugation to isolate the microsomal fraction

    • Resuspend the microsomal pellet in appropriate buffer

  • Chitin synthase activity assay:

    • Measure the incorporation of UDP-N-acetylglucosamine into chitin

    • Include appropriate controls with and without specific activators/inhibitors

    • Quantify activity as nM UDP-N-acetylglucosamine incorporated per mg protein per minute

  • Data analysis:

    • Compare activities between wild-type and recombinant strains

    • Analyze the effect of different activators and inhibitors

    • Determine kinetic parameters (Km, Vmax) for the enzyme

This methodology has been successfully employed in related Aspergillus species and can be adapted for A. oryzae CHS7 studies .

How can researchers investigate the regulatory network controlling CHS7 expression in Aspergillus oryzae?

To elucidate the regulatory network controlling CHS7 expression, researchers should implement a multi-omics approach:

  • Transcriptomic analysis:

    • Perform RNA-seq under various developmental stages and stress conditions

    • Compare expression profiles between wild-type and mutant strains lacking key regulators

    • Identify co-expressed genes that form regulatory modules with CHS7

  • Chromatin immunoprecipitation (ChIP-seq):

    • Generate strains expressing tagged versions of suspected transcription factors

    • Perform ChIP-seq to identify direct binding sites in the CHS7 promoter

    • Validate binding using electrophoretic mobility shift assays (EMSA)

  • Promoter analysis:

    • Create reporter constructs with full and truncated CHS7 promoter regions

    • Identify minimal promoter elements required for developmental expression

    • Mutate putative binding sites to confirm their functional relevance

  • Interactome analysis:

    • Perform yeast two-hybrid or affinity purification-mass spectrometry to identify protein interactors

    • Map the protein-protein interaction network involving CHS7 and its regulators

    • Validate key interactions with co-immunoprecipitation or bimolecular fluorescence complementation

This comprehensive approach allows for detailed mapping of the regulatory networks controlling CHS7 expression in response to developmental and environmental signals.

What strategies can be employed to investigate potential contradictions in CHS7 function across different Aspergillus species?

When investigating potential contradictions in CHS7 function across Aspergillus species, researchers should employ the following systematic approach:

  • Ortholog identification and phylogenetic analysis:

    • Perform sequence-based ortholog identification across species

    • Construct phylogenetic trees to establish evolutionary relationships

    • Identify conserved domains and species-specific sequence variations

  • Functional complementation studies:

    • Clone CHS7 orthologs from different species

    • Express these orthologs in CHS7-deficient strains of various species

    • Assess the degree of functional complementation

  • Comparative phenotyping:

    • Generate parallel CHS7 deletion mutants in multiple Aspergillus species

    • Apply identical phenotypic characterization protocols across species

    • Identify species-specific and conserved phenotypes

  • Conditional expression systems:

    • Create conditional mutants using inducible/repressible promoters

    • Compare the timing and severity of phenotypes upon CHS7 depletion

    • Identify potential compensatory mechanisms in different species

  • Contradiction resolution framework:

    • Document all apparent contradictions in experimental findings

    • Classify contradictions as self-contradictions (within a study), pair contradictions (between two studies), or conditional contradictions (context-dependent)

    • Design targeted experiments to resolve each type of contradiction

This systematic approach helps identify genuine functional differences versus methodological artifacts when comparing CHS7 function across Aspergillus species.

How does CHS7 contribute to cell wall integrity pathways and stress responses in Aspergillus oryzae?

CHS7's role in cell wall integrity and stress responses can be investigated through:

  • Cell wall integrity pathway analysis:

    • Monitor phosphorylation status of MAP kinases (e.g., Mpk1/Slt2) in wild-type versus CHS7 mutants

    • Assess genetic interactions between CHS7 and known cell wall integrity pathway components

    • Examine transcriptional responses to cell wall stress in CHS7 mutants

  • Stress-specific transcriptional profiling:

    • Compare transcriptomes of wild-type and CHS7 mutants under various stresses

    • Identify stress-responsive genes regulated by CHS7

    • Map CHS7-dependent and independent stress response pathways

  • Biochemical analysis of cell wall composition:

    • Quantify major cell wall components (chitin, glucan, mannan) in wild-type versus mutants

    • Analyze structural modifications under stress conditions

    • Assess cell wall architecture using electron microscopy

  • Protein localization during stress:

    • Monitor CHS7 and chitin synthase localization during normal growth and stress conditions

    • Track vesicle trafficking patterns in wild-type versus mutants

    • Identify stress-induced changes in CHS7-dependent trafficking

Through these approaches, researchers can establish how CHS7 contributes to maintaining cell wall integrity during stress conditions, which is critical for understanding fungal adaptation mechanisms .

What statistical approaches are recommended for analyzing chitin content and synthase activity data in CHS7 studies?

For robust statistical analysis of chitin content and synthase activity data:

  • Experimental design considerations:

    • Ensure adequate biological replicates (minimum n=3)

    • Include appropriate controls (positive, negative, and reference strains)

    • Account for batch effects through randomization and blocking designs

  • Statistical methods for chitin content analysis:

    • Use analysis of variance (ANOVA) for comparing multiple strains

    • Apply post-hoc tests (e.g., Tukey's HSD) for pairwise comparisons

    • Consider non-parametric alternatives (Kruskal-Wallis) if normality assumptions are violated

  • Enzyme kinetics analysis:

    • Apply regression models for determining Km and Vmax parameters

    • Use analysis of covariance (ANCOVA) to compare enzyme kinetics between strains

    • Implement enzyme inhibition models for inhibitor studies

  • Data presentation recommendations:

    • Present individual data points alongside means and standard deviations

    • Use boxplots or violin plots to display data distributions

    • Include clear statistical significance indicators

Sample data table format for chitin content analysis:

StrainHyphal Chitin Content (μg/mg)Conidial Chitin Content (μg/mg)Chitin Synthase Activity (nM/mg/min)
Wild-type25.3 ± 2.138.7 ± 3.48.4 ± 0.7
ΔCHS724.8 ± 1.922.9 ± 2.8*4.2 ± 0.5*
CHS7-OE26.1 ± 2.345.6 ± 4.1*12.7 ± 1.1*

*Significantly different from wild-type (p < 0.05, n=3)

How can researchers integrate transcriptomic and functional data to understand CHS7's role in Aspergillus oryzae?

To effectively integrate transcriptomic and functional data:

  • Multi-omics data integration approach:

    • Correlate gene expression patterns with phenotypic traits

    • Identify gene co-expression networks involving CHS7

    • Apply pathway enrichment analysis to identify biological processes associated with CHS7

  • Network analysis methods:

    • Construct gene regulatory networks using algorithms like WGCNA

    • Identify hub genes and modules connected to CHS7 function

    • Apply network perturbation analysis to predict effects of CHS7 modification

  • Comparative transcriptomics across species:

    • Analyze orthologous gene expression patterns across Aspergillus species

    • Identify conserved and species-specific transcriptional responses

    • Correlate expression differences with functional divergence

  • Integrative visualization techniques:

    • Generate heatmaps showing expression patterns of chitin-related genes

    • Create pathway maps highlighting CHS7's position in cell wall biogenesis

    • Develop interactive visualizations of multi-dimensional data

Example transcriptomic data demonstrating chitin-related gene expression across Aspergillus species:

GeneA. nidulansA. flavusA. fumigatusFunction
chsA+2.8*+2.4*+3.1*Chitin synthase A
chsB+3.2*+1.9*+2.7*Chitin synthase B
chsC+1.9*ND+2.2*Chitin synthase C
chsD+2.5*ND+2.1*Chitin synthase D
chsF+3.8*+3.5*+3.3*Chitin synthase F
chsG+2.4*+2.6*+1.8*Chitin synthase G
chs5+1.7*NDNDChitin synthase 5
chs7+4.2*+3.9*+3.7*Chitin synthase export chaperone

Values represent log2 fold change in conidia compared to hyphae. *p < 0.05, ND = Not detected

This integrated approach provides a comprehensive understanding of CHS7's role within the broader context of fungal cell wall biogenesis and development.

What approaches can be used to analyze potential contradictions in published data about CHS7 function?

To systematically analyze contradictions in published CHS7 data:

  • Contradiction classification framework:

    • Categorize contradictions as self-contradictory (within a study), contradicting document pairs (between two studies), or conditional contradictions (context-dependent)

    • Document the specific claims and evidence presented in each contradicting source

    • Identify potential causes for contradictions (methodological differences, species variation, environmental conditions)

  • Methodological variance analysis:

    • Compare experimental protocols between contradicting studies

    • Identify key differences in strain backgrounds, growth conditions, and analytical methods

    • Evaluate the sensitivity and specificity of different measurement techniques

  • Meta-analysis approach:

    • Apply formal meta-analysis techniques to synthesize quantitative data across studies

    • Calculate effect sizes and confidence intervals for key measurements

    • Assess publication bias and study quality using established criteria

  • Replication studies design:

    • Develop experimental designs that specifically address contradictions

    • Include conditions and methods from contradicting studies in parallel

    • Implement blinded analyses to minimize confirmation bias

  • Computational modeling:

    • Develop models that can accommodate apparently contradictory observations

    • Test whether contextual differences can explain divergent results

    • Generate testable predictions to resolve contradictions

How might CRISPR-Cas9 technology be applied to advance research on CHS7 in Aspergillus oryzae?

CRISPR-Cas9 technology offers several advanced applications for CHS7 research:

  • Precise genome editing:

    • Generate clean deletions, point mutations, or insertions without marker genes

    • Create conditional alleles through insertion of inducible systems

    • Introduce epitope tags at endogenous loci for protein studies

  • Base editing applications:

    • Introduce specific amino acid changes to study structure-function relationships

    • Modify regulatory sequences to alter CHS7 expression patterns

    • Create silent mutations to study codon optimization effects

  • CRISPRi/CRISPRa strategies:

    • Implement CRISPR interference to repress CHS7 expression without genetic deletion

    • Apply CRISPR activation to enhance CHS7 expression

    • Create multiplexed systems to simultaneously modify CHS7 and related genes

  • Methodological approach:

    • Design guide RNAs with high specificity using validated algorithms

    • Optimize Cas9 expression for Aspergillus oryzae

    • Employ ribonucleoprotein (RNP) delivery for transient editing

    • Screen transformants using high-throughput phenotypic assays

  • Validation strategies:

    • Confirm edits by sequencing

    • Verify phenotypic effects through comprehensive analysis

    • Complement mutations to demonstrate specificity

This technology allows for more sophisticated genetic manipulation than traditional approaches, enabling nuanced investigation of CHS7 function .

What are the potential applications of understanding CHS7 function for developing novel antifungal strategies?

Understanding CHS7 function has significant implications for antifungal development:

  • Target validation approaches:

    • Assess the essentiality of CHS7 across multiple pathogenic fungi

    • Determine the consequences of CHS7 inhibition on fungal viability

    • Identify compensatory mechanisms that might confer resistance

  • Drug discovery strategies:

    • Develop high-throughput screens for compounds that disrupt CHS7 function

    • Design structure-based virtual screening for CHS7-targeted inhibitors

    • Explore natural products that interfere with chitin synthase trafficking

  • Combination therapy approaches:

    • Test synergistic effects between CHS7 inhibitors and existing antifungals

    • Develop dual-targeting strategies affecting both CHS7 and chitin synthases

    • Evaluate the potential for sensitizing resistant strains through CHS7 inhibition

  • Translational research opportunities:

    • Test leading compounds in infection models

    • Develop biomarkers for monitoring therapeutic efficacy

    • Address potential toxicity through selective targeting

  • Resistance management strategies:

    • Characterize potential resistance mechanisms to CHS7-targeted therapies

    • Design combination approaches to prevent resistance development

    • Develop alternating treatment protocols to minimize selective pressure

By targeting the export chaperone rather than the enzymes themselves, this approach might overcome some limitations of current chitin synthase inhibitors and provide new avenues for combating fungal infections .

How might systems biology approaches advance our understanding of CHS7's role in the broader context of fungal cell wall biogenesis?

Systems biology offers powerful frameworks for investigating CHS7 within fungal cell wall biogenesis:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, metabolomics, and interactomics data

    • Apply machine learning approaches to identify patterns and relationships

    • Develop predictive models of cell wall assembly and remodeling

  • Genome-scale metabolic modeling:

    • Incorporate chitin synthesis pathways into genome-scale metabolic models

    • Simulate the effects of CHS7 perturbation on metabolic flux

    • Identify metabolic vulnerabilities associated with CHS7 dysfunction

  • Protein interaction network analysis:

    • Map the complete interactome of CHS7 and associated chitin synthases

    • Identify hub proteins and essential interactions

    • Characterize the dynamics of these interactions during development and stress

  • In silico perturbation studies:

    • Simulate the effects of genetic or environmental perturbations on the cell wall system

    • Identify emergent properties and non-intuitive relationships

    • Generate testable hypotheses for experimental validation

  • Comparative systems analysis across species:

    • Compare system architectures between different Aspergillus species

    • Identify conserved modules and species-specific adaptations

    • Relate system differences to ecological niches and pathogenic potential

This systems-level understanding would provide a comprehensive view of how CHS7 functions within the complex process of fungal cell wall assembly, maintenance, and remodeling under different conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.