Recombinant Aspergillus oryzae Cytochrome c oxidase assembly protein cox16, mitochondrial (cox16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
cox16; AO090206000015; Cytochrome c oxidase assembly protein cox16, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
13-134
Protein Length
Full Length of Mature Protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
cox16
Target Protein Sequence
TTASSSLGERIGETYRARLPKHPFLLFGFPFVMIIVAGSFALTPAAALRYERYDRKVQQL SQEEAMNLGLRGPDGEEGIKRNPRRRIIGDEREEYYRLMAKDLDNWEQKRVQRFKGEPDG KL
Uniprot No.

Target Background

Function

Essential for the assembly of mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. It may also play a role in merging the COX1 and COX2 assembly pathways.

Database Links
Protein Families
COX16 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the primary function of cox16 in mitochondrial respiration?

Cox16 is a conserved protein essential for the biogenesis of cytochrome c oxidase, which is the terminal enzyme complex (Complex IV) of the electron transport chain. Cox16 participates in merging the COX1 and COX2 assembly lines, which are critical components of the cytochrome c oxidase complex . This protein specifically interacts with newly synthesized COX2 and facilitates the association of COX2 with COX1-containing assembly intermediates, thus promoting the progression of cytochrome c oxidase assembly . In experimental models, knockout of COX16 results in a severe reduction of cytochrome c oxidase activity (to approximately 65% compared to wild type) and enzyme amount (to approximately 50%) .

Where is cox16 localized within the mitochondria?

Cox16 is an integral inner mitochondrial membrane protein with a transmembrane span. Studies using hypo-osmotic swelling and carbonate extraction experiments have demonstrated that cox16 is resistant to carbonate extraction and becomes accessible to protease treatment only when the outer membrane is disrupted . In human cells, the C-terminus of COX16 faces the intermembrane space (IMS) . This subcellular localization is consistent with its function in cytochrome c oxidase assembly, which occurs at the inner mitochondrial membrane.

What are the optimal conditions for expressing recombinant Aspergillus oryzae cox16 in heterologous systems?

When expressing recombinant A. oryzae cox16, consider the following methodological approach:

  • Expression System Selection: E. coli systems may be suitable for basic structural studies, but for functional analyses, eukaryotic expression systems (yeast or insect cells) are preferable to ensure proper protein folding and post-translational modifications.

  • Tagging Strategy: C-terminal tagging is recommended based on human COX16 studies where C-terminally FLAG-tagged proteins maintained functionality . When designing constructs, consider that cox16 is an integral membrane protein, so the tag placement should not interfere with membrane insertion.

  • Solubilization Conditions: For membrane protein extraction, digitonin has been successfully used for cox16 homologs to preserve protein-protein interactions . Typical digitonin concentration ranges from 1-2% for initial solubilization.

  • Purification Parameters: Two-step purification protocols combining affinity chromatography with size exclusion chromatography can yield high purity protein suitable for biochemical analyses.

ParameterRecommended ConditionRationale
Expression systemEukaryotic (P. pastoris or insect cells)Proper folding of membrane protein
Induction temperature25-28°CReduced aggregation of membrane proteins
Solubilization agent1% DigitoninPreserves protein-protein interactions
Buffer pH7.2-7.5Physiological pH range for mitochondrial proteins
Salt concentration150-300 mM NaClStabilizes membrane proteins while preventing aggregation

How can the interaction between cox16 and other assembly factors be experimentally assessed?

To investigate protein-protein interactions involving cox16, the following methodological approaches are recommended:

  • Co-immunoprecipitation (Co-IP): Immunoisolation using antibodies against cox16 or potential interaction partners can be performed after solubilizing mitochondria with mild detergents like digitonin. This method has successfully revealed interactions between COX16 and newly synthesized COX2, as well as copper center-forming metallochaperones SCO1, SCO2, and COA6 .

  • Blue Native PAGE (BN-PAGE): This technique separates protein complexes in their native state and can be followed by second-dimension SDS-PAGE (2D-BN/SDS-PAGE) to visualize complex composition. This approach has successfully demonstrated the association of COX16 with COX2 and MITRAC assembly intermediates .

  • Pulse-chase Analysis: To examine the role of cox16 in the stability of newly synthesized mitochondrial-encoded subunits, radiolabeling with [35S]methionine followed by chase periods can be performed . This reveals whether cox16 affects the stability of specific proteins over time.

  • Proximity-based Labeling: Methods such as BioID or APEX2 proximity labeling can identify proteins in close proximity to cox16 in living cells, potentially revealing transient interactions not captured by co-IP.

  • Yeast Two-hybrid Assays: For mapping specific interaction domains, modified membrane yeast two-hybrid systems can be employed using truncated versions of cox16.

How does cox16 contribute to copper insertion into the CuA site of cytochrome c oxidase?

Cox16 plays a critical role in copper insertion into the CuA site of cytochrome c oxidase, particularly through its interactions with metallochaperones. The formation of the CuA center in COX2 involves a coordinated process where:

  • Cox16 specifically interacts with newly synthesized COX2 and the copper center-forming metallochaperones SCO1, SCO2, and COA6 .

  • The recruitment of SCO1 to the COX2-assembly module is COX16-dependent, as demonstrated in knockout experiments . When COX16 is absent, SCO1 association with COX2 is compromised, while SCO2 association remains unaffected .

  • Patient-mimicking mutations in SCO1 (G132S and P174L) significantly reduce association with COX16 while maintaining interaction with COX2 . This suggests that the pathology in these patients may result from disrupted COX16-SCO1 interaction rather than defective COX2 recruitment.

These findings collectively implicate cox16 as an essential component of the copper insertion machinery that facilitates proper metallation of the CuA site. For experimental approaches, researchers should consider analyzing metallation states using spectroscopic methods (EPR, XAS) in systems with wild-type versus mutant cox16 to directly assess copper incorporation efficiency.

What is the sequence of molecular events in which cox16 participates during cytochrome c oxidase assembly?

Based on current evidence, the molecular sequence involving cox16 in cytochrome c oxidase assembly appears to follow these steps:

  • Initial Interaction: Cox16 specifically interacts with newly synthesized COX2 .

  • Metallochaperone Recruitment: Cox16 facilitates the recruitment of copper-insertion machinery components, particularly SCO1, to the COX2 module .

  • CuA Site Formation: Through interactions with metallochaperones SCO1, SCO2, and COA6, cox16 contributes to the formation of the CuA copper center in COX2 .

  • Module Merging: Cox16 escorts the metallated COX2 to COX1-containing assembly intermediates (MITRAC complexes) . This is evidenced by the finding that in the absence of COX16, the association of COX2 with MITRAC12 or C12ORF62 (components of COX1 assembly modules) is drastically reduced .

  • Progressive Assembly: After facilitating the merging of COX1 and COX2 modules, cox16 dissociates from the maturing complex before the formation of respiratory chain supercomplexes, as cox16 is not detected in RIESKE protein purifications of supercomplexes .

This sequence highlights cox16's dual role in CuA site formation and in bridging independent assembly pathways of COX1 and COX2. When designing experiments to investigate this process in A. oryzae, researchers should consider establishing stable cell lines with inducible knockdown of cox16 and applying time-resolved proteomics to track assembly intermediate formation.

How do mutations in cox16 affect mitochondrial respiratory function?

Complete knockout of COX16 has significant consequences for mitochondrial respiratory function:

For investigating the effects of point mutations rather than complete absence of cox16, site-directed mutagenesis of conserved residues followed by functional complementation assays would be informative. Measuring oxygen consumption rates, ATP production, and mitochondrial membrane potential in cells expressing different cox16 variants can provide quantitative assessment of respiratory function.

How can researchers differentiate between direct and indirect effects of cox16 manipulation in experimental systems?

When interpreting data from cox16 manipulation experiments, researchers should employ the following strategies to distinguish direct from indirect effects:

  • Rescue Experiments: Re-expression of wild-type cox16 in knockout cells should reverse direct effects. If phenotypes are not rescued, they may represent secondary adaptations or off-target effects .

  • Timecourse Analyses: Utilize inducible knockout or knockdown systems to establish the temporal sequence of events following cox16 depletion. Early effects are more likely to be direct consequences.

  • Interaction Specificity Controls: When analyzing protein-protein interactions, compare the interaction profile of cox16 with those of other assembly factors. In human studies, COX16 shows a unique interaction pattern, associating specifically with newly synthesized COX2 but not other mitochondrial translation products .

  • Parallel Pathway Analysis: Examine multiple assembly pathways simultaneously. For instance, while COX16 knockout affects cytochrome c oxidase, other respiratory complexes (like complex V) remain unaffected, confirming specificity of the observed effects .

  • Comparative Analysis with Known Assembly Factor Mutations: Compare phenotypes with those resulting from manipulation of other assembly factors. For example, blocks in early stages of COX1 assembly (SURF1 knockout) lead to accumulation of COX2-containing assembly modules with COX16, providing insight into the assembly sequence .

What are the common pitfalls in analyzing cox16 function and how can they be avoided?

When studying cox16 function, researchers should be aware of these potential pitfalls and their solutions:

  • Overlooking Transient Interactions: Cox16 forms relatively weak or transient interactions with some partners. For example, the interaction between COX16 and MITRAC12 is significantly lower in magnitude compared to other COX2-associated proteins .

    • Solution: Use optimized crosslinking protocols or proximity labeling approaches to capture transient interactions. Native purification methods have successfully enriched MITRAC12-COX16 complexes that were not apparent in standard immunoisolations .

  • Confounding Effects of Compensatory Mechanisms: Long-term knockouts may trigger compensatory upregulation of parallel pathways.

    • Solution: Employ acute inducible systems rather than stable knockouts when possible, and monitor expression of related assembly factors.

  • Misinterpreting Assembly Defects: Reduced levels of mature complexes can result from either assembly defects or increased degradation.

    • Solution: Combine steady-state analyses with pulse-chase experiments to distinguish between assembly and stability issues. In COX16 knockout cells, both reduced assembly of COX2 into mature cytochrome c oxidase and decreased stability of newly synthesized COX2 were observed .

  • Detergent-Dependent Interaction Artifacts: The choice of detergent for membrane protein solubilization significantly impacts which interactions are preserved.

    • Solution: Compare multiple detergents with varying stringency (digitonin, DDM, Triton X-100) when analyzing protein-protein interactions. Digitonin solubilization has been successfully used to maintain physiologically relevant interactions of cox16 .

How should researchers interpret data from different model systems when studying cox16?

When translating findings between different model systems (e.g., from human to A. oryzae cox16), consider these methodological approaches:

  • Sequence and Structure Comparison: Perform comprehensive sequence alignment and structural prediction across species. Note that human COX16 lacks an N-terminal presequence present in yeast Cox16, which likely contributes to functional differences .

  • Cross-Species Complementation: Assess whether cox16 from one species can complement loss-of-function in another. Human COX16 does not complement the yeast mutant strain, indicating functional divergence despite conservation .

  • Domain-Specific Analysis: When full complementation fails, chimeric proteins containing domains from different species can help identify functionally conserved regions.

  • Interaction Network Mapping: Compare the interaction partners of cox16 across species using consistent methods. While core functions may be conserved, the exact interaction networks might differ.

  • Phenotypic Spectrum Assessment: Compare the severity and nature of phenotypes resulting from cox16 dysfunction across species. This can reveal which aspects of cox16 function are most evolutionarily conserved.

Model SystemAdvantagesLimitationsKey Considerations
YeastGenetic manipulation ease, Rapid growthFurther evolutionary distance from humansCox16 contains presequence not present in human homolog
Mammalian cellsCloser to human physiology, Complex assembly pattern similar to humansMore resource-intensiveBetter model for studying interactions with metallochaperones
A. oryzaeNative context for the protein of interestLess established genetic toolsImportant for fungal-specific features

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.