Recombinant Aspergillus oryzae GPI mannosyltransferase 3 (gpi10)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, kindly indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary based on the purchase method or location. For specific delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice delivery is required, please contact us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is discouraged. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein typically maintains its stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag preference, please inform us. We will prioritize developing the specified tag according to your requirement.
Synonyms
gpi10; AO090023000629; GPI mannosyltransferase 3; GPI mannosyltransferase III; GPI-MT-III; Glycosylphosphatidylinositol-anchor biosynthesis protein 10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-728
Protein Length
full length protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
gpi10
Target Protein Sequence
MSTSSRRRRSPLELSSSRSSSSSSSSYASWASTTSPSTSTSTPPSLSRTTTVSTSHVFLF LLAFRLLNALSLRTFFQPDEFFQSLEPAWQTAFGETHGANGDTICGLPSILCYLLQFILS PTLPRALFVSPPHSAILSAIGDLYTWKLARYVYGRRSHEAWAALALTVLSPWQWFCSTRT LSNCLETTITIVALNLWPWEWSSESTPTVQPRRNTRSTTRDTGLDNTGDGAVVVRLRKCL TLAALACILRPTNILIWMGLAGVAWFRSAWRERTILCREVLLCGVSVLTGSVVLDRLYYG LWTFPPLKFLYFNIAQSLAVYYGRNDWHYYATQGYPLLLTTALPFTLVGLYRTLSQSQST INTRNVSVQTQLAAICLLMPLVLSLISHKEVRFIYPLLPSLHVLTAPPLVDFFLPAVSRS NGAYMPRRLSLVFLLLVNITVAIYTSVYHASGTLNVLSYLRDQQQAHTTVDKSAYSPGSS QRITAGFLMPCHSTPWRSHLVDPNIHAWALSCEPPVDLTEPQKAVYVDEADQFYNDPSQF LRENMVGGLRHLPRKPSYLASSKSLEASPQAYQQATPHEWPDYLIFFAQLEPTLHSFLRS SSYGECWRTWNTAWHDDSRRRGDIIVWCLDPTEQAAWRSATRKRTLEHRDHQFDRIVETL RKNAPAEILPLDSMDILSVRAIGLLNLVLVLALGTTQTVLVRNPVTSLEEVLMDPSDMDL AKIFQEEN
Uniprot No.

Target Background

Function
GPI mannosyltransferase 3 (gpi10) from *Aspergillus oryzae* is an enzyme involved in glycosylphosphatidylinositol-anchor biosynthesis. It catalyzes the transfer of the third mannose residue to Man2-GlcN-acyl-PI during the assembly of the GPI precursor.
Database Links
Protein Families
Glycosyltransferase 22 family, PIGB subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is GPI mannosyltransferase 3 (gpi10) and what is its primary function in Aspergillus oryzae?

GPI mannosyltransferase 3 (gpi10) in Aspergillus oryzae is an enzyme involved in the biosynthesis of glycosylphosphatidylinositol (GPI) anchors. Its primary function is to participate in the mannosylation process of GPI-anchors, which are essential glycolipid structures that attach various proteins to the outer leaflet of the plasma membrane in eukaryotes. In fungi like A. oryzae, GPI-anchored proteins play crucial roles in cell-cell interactions, adhesion, and cell wall biogenesis. The enzyme is classified under EC 2.4.1.- (glycosyltransferases) and is also known as GPI mannosyltransferase III (GPI-MT-III) or Glycosylphosphatidylinositol-anchor biosynthesis protein 10 . Similar to related proteins in other fungi, it likely participates in the addition of mannose residues to the glycan portion of the GPI anchor precursor, which is a critical step in the maturation of these structures before their attachment to proteins .

How does A. oryzae GPI mannosyltransferase 3 compare to similar enzymes in other fungi?

A. oryzae GPI mannosyltransferase 3 shares significant functional and structural similarities with mannosyltransferases in other fungal species, though with distinct characteristics. Research on related enzymes provides valuable comparative insights:

OrganismEnzymeKey SimilaritiesNotable DifferencesReference
Aspergillus fumigatusCap59-like protein A (ClpA)Acts as α1,3-mannosyltransferase on GPI-anchorsSpecifically does not act on Manα1,2IPC substrates
Cryptococcus neoformansCap59pHomologous glycosyltransferaseInvolved in capsule formation and virulence
Saccharomyces cerevisiaeGpi10pSimilar function in GPI-anchor biosynthesisDifferent substrate specificity

What expression systems are most effective for producing recombinant A. oryzae GPI mannosyltransferase 3?

Several expression systems can be employed for producing recombinant A. oryzae GPI mannosyltransferase 3, each with specific advantages depending on research objectives:

Fungal Expression Systems:
The most effective approach often involves homologous expression in modified A. oryzae strains. Recent research has demonstrated that engineered A. oryzae strains lacking both α-1,3-glucan and galactosaminogalactan (AGΔ-GAGΔ) yield significantly higher recombinant protein production compared to wild-type strains . This improved productivity results from better culture rheology and reduced hyphal aggregation. When using these optimized strains in a 5-L lab-scale bioreactor with intermittent glucose addition, researchers observed dramatically increased protein yields while maintaining similar mycelial weight to wild-type cultures .

For methodology implementation:

  • Use AGΔ-GAGΔ strain or similar engineered A. oryzae hosts

  • Employ batch culture with intermittent glucose feeding

  • Maintain optimal agitation (approximately 600 rpm) to minimize apparent viscosity

  • Monitor culture rheology throughout the production process

This approach is particularly valuable for complex membrane proteins like GPI mannosyltransferase 3, as homologous expression helps ensure proper folding, post-translational modifications, and membrane insertion .

What are the optimal conditions for purifying recombinant A. oryzae GPI mannosyltransferase 3 while maintaining its enzymatic activity?

Purification of membrane-associated enzymes like GPI mannosyltransferase 3 requires specialized approaches to maintain structural integrity and enzymatic activity. Based on protocols used for similar enzymes, the following methodological framework is recommended:

  • Membrane Extraction:

    • Harvest cells and create spheroplasts using enzymatic treatment (e.g., Zymolyase)

    • Disrupt spheroplasts via gentle mechanical methods

    • Isolate membrane fractions through differential centrifugation

    • Extract the protein using mild detergents (e.g., DDM, CHAPS) to solubilize while preserving activity

  • Chromatographic Purification:

    • Employ immobilized metal affinity chromatography (IMAC) if using His-tagged constructs

    • Consider ion exchange chromatography as an orthogonal purification step

    • Utilize size exclusion chromatography for final polishing and buffer exchange

  • Activity Preservation:

    • Maintain critical buffer components throughout purification:

      • Stabilizing agents: glycerol (30-50%)

      • Protease inhibitors: complete cocktail with emphasis on serine protease inhibitors

      • Reducing agents: DTT or β-mercaptoethanol

    • Avoid repeated freeze-thaw cycles

  • Quality Assessment:

    • Verify purity via SDS-PAGE and Western blotting

    • Assess activity using appropriate enzymatic assays measuring mannosyltransferase function

    • Confirm protein integrity via mass spectrometry

The final purified product should be stored in Tris-based buffer containing 50% glycerol at -20°C for routine use or -80°C for extended storage . Working aliquots maintained at 4°C remain viable for approximately one week .

How should researchers address the challenge of expression tag selection for optimal activity of recombinant GPI mannosyltransferase 3?

The selection of appropriate expression tags is critical for successful production and purification of functionally active GPI mannosyltransferase 3. This decision requires careful consideration of the enzyme's structure, localization, and catalytic mechanism:

Methodological approach to tag selection:

  • N-terminal vs. C-terminal placement:

    • As GPI mannosyltransferase 3 is a membrane-associated enzyme, tag placement should avoid disrupting membrane insertion sequences

    • Structural prediction algorithms should be employed to identify optimal tag insertion points that minimize interference with transmembrane domains

    • Consider dual-tagged constructs for validation studies, comparing activity between differently tagged variants

  • Tag type considerations:

    • Affinity tags: His6 tags offer efficient purification but may impact enzyme activity; alternative tags like FLAG or Strep-II should be evaluated

    • Solubility-enhancing tags: MBP or SUMO tags can improve solubility but may affect native membrane association

    • Cleavable linkers: TEV or PreScission protease sites allow tag removal post-purification

  • Experimental validation:

    • Construct multiple variants with different tag configurations

    • Systematically compare expression levels, purification efficiency, and enzymatic activity

    • Conduct structural integrity assessments using circular dichroism or limited proteolysis

For recombinant A. oryzae GPI mannosyltransferase 3, the scientific literature suggests that the specific tag type should be determined during the production process rather than predetermined, allowing flexibility to optimize based on experimental outcomes . This approach permits adaptation based on expression levels and activity results obtained during development.

What assays can be used to measure the enzymatic activity of recombinant A. oryzae GPI mannosyltransferase 3?

Measuring the enzymatic activity of GPI mannosyltransferase 3 requires specialized assays that assess its ability to transfer mannose residues to GPI anchor precursors. Based on methodologies developed for similar enzymes, the following approaches are recommended:

In vitro enzymatic activity assays:

  • Radioactive substrate incorporation assay:

    • Utilize radiolabeled GDP-[³H]mannose or GDP-[¹⁴C]mannose as the donor substrate

    • Prepare GPI anchor precursor acceptor substrates either through chemical synthesis or isolation from cells

    • Measure incorporation of radioactive mannose into the GPI structure

    • Quantify results using scintillation counting after product separation

  • HPLC/MS-based assay:

    • React enzyme with unlabeled GDP-mannose and appropriate GPI precursor substrates

    • Analyze reaction products using HPLC coupled with mass spectrometry

    • Detect and quantify mannosylated products based on mass shifts

    • This approach allows for detailed structural characterization of reaction products

  • Fluorescence-based assays:

    • Employ fluorescently labeled GPI anchor precursors

    • Monitor changes in fluorescence properties upon mannosylation

    • This method offers higher throughput potential but may require complex substrate synthesis

By analyzing the activity patterns with various substrates, researchers can determine the specific mannosylation position (likely α1,3-linkage based on homology to characterized enzymes like ClpA in A. fumigatus) . Activity should be measured under varying conditions (pH, temperature, metal ion concentrations) to establish optimal enzymatic parameters.

How can researchers effectively design experiments to study the role of GPI mannosyltransferase 3 in cell wall biogenesis and hyphal growth?

Designing experiments to investigate the role of GPI mannosyltransferase 3 in cell wall biogenesis and hyphal growth requires a multifaceted approach combining genetic, biochemical, and microscopy techniques:

Comprehensive experimental design strategy:

  • Genetic manipulation approaches:

    • Generate conditional knockout or knockdown mutants using CRISPR/Cas9 or RNAi systems

    • Create point mutations in catalytic domains to produce enzymatically inactive variants

    • Develop fluorescently tagged versions for localization studies

    • Implement complementation studies with wild-type and mutant genes

  • Phenotypic characterization:

    • Analyze growth rate, colony morphology, and hyphal branching patterns

    • Assess cell wall composition using specific stains (e.g., Calcofluor White, Congo Red)

    • Measure sensitivity to cell wall-disrupting agents (e.g., Caspofungin, Congo Red)

    • Evaluate protein secretion efficiency and profile alterations

  • Cell wall component analysis:

    • Fractionate cell wall components (alkali-soluble vs. alkali-insoluble)

    • Quantify α- and β-glucans, chitin, and mannoproteins

    • Perform structural analysis of GPI-anchored proteins

    • Investigate changes in crosslinking between cell wall components

  • Advanced microscopy approaches:

    • Utilize transmission electron microscopy to examine cell wall ultrastructure

    • Employ immunogold labeling to localize GPI-anchored proteins

    • Apply live-cell imaging to monitor dynamic processes

    • Use atomic force microscopy to assess cell wall mechanical properties

These approaches should be complemented with transcriptomic and proteomic analyses to identify compensatory mechanisms and broader impacts on cellular physiology. When analyzing results, researchers should recognize that alterations in GPI-anchored proteins might produce complex phenotypes due to their diverse roles in cell wall organization, signaling, and environmental interactions .

What is the current understanding of the role of GPI mannosyltransferase 3 in pathogenicity and potential biotechnological applications?

The role of GPI mannosyltransferase 3 in fungal pathogenicity and its potential biotechnological applications spans several important research areas:

Pathogenicity relevance:

Studies of related enzymes in pathogenic fungi reveal that proper GPI-anchor biosynthesis is critical for virulence. In Aspergillus fumigatus, the related enzyme Cap59-like protein A (ClpA) has been characterized as an α1,3-mannosyltransferase involved in GPI-anchor maturation . Disruption of GPI-anchor biosynthesis pathways typically results in:

  • Compromised cell wall integrity and altered host interactions

  • Reduced ability to adhere to host surfaces

  • Impaired response to environmental stresses

  • Modified immune recognition profiles

While A. oryzae is generally recognized as safe (GRAS) and non-pathogenic, understanding its GPI biosynthesis machinery provides valuable insights into the evolution of pathogenicity factors in related Aspergillus species .

Biotechnological applications:

Several promising biotechnological applications have emerged from research on fungal GPI mannosyltransferases:

  • Enhanced recombinant protein production:
    Recent studies demonstrate that engineered A. oryzae strains with modified cell wall components (lacking α-1,3-glucan and galactosaminogalactan) show significantly improved recombinant protein production . Understanding GPI biosynthesis pathways could lead to further strain optimization strategies.

  • Cell surface display technologies:
    GPI-anchoring mechanisms can be exploited to display heterologous proteins on fungal cell surfaces, creating whole-cell biocatalysts with diverse applications.

  • Antimicrobial target development:
    The essential nature of GPI biosynthesis for fungal viability makes components of this pathway potential targets for novel antifungal strategies.

  • Glycoengineering applications:
    Manipulating mannosyltransferases involved in GPI biosynthesis could enable production of glycoproteins with custom glycan structures for pharmaceutical applications.

  • Paratransgenesis approaches:
    As demonstrated with other recombinant A. oryzae strains, engineered fungi can be developed for specialized applications such as malaria control, where recombinant A. oryzae was modified to secrete anti-plasmodial effector peptides .

The convergence of these research directions suggests significant potential for GPI mannosyltransferase 3 in both fundamental mycology and applied biotechnology fields.

How do post-translational modifications affect the function of recombinant A. oryzae GPI mannosyltransferase 3, and how can researchers ensure proper modification profiles?

Post-translational modifications (PTMs) significantly impact the function of membrane-associated glycosyltransferases like GPI mannosyltransferase 3. Understanding and controlling these modifications is crucial for producing functionally relevant recombinant proteins:

Critical PTMs and their functional impacts:

  • N-glycosylation:

    • Potential N-glycosylation sites can be predicted from the amino acid sequence using motif analysis (Asn-X-Ser/Thr)

    • N-glycosylation may affect protein folding, stability, and enzymatic activity

    • Expression systems with divergent glycosylation machinery may produce proteins with altered properties

  • Phosphorylation:

    • Regulatory phosphorylation sites can modify enzyme activity and interactions

    • Kinase recognition motifs should be preserved in recombinant constructs

  • Lipid modifications:

    • Some membrane-associated glycosyltransferases require lipid modifications for proper membrane association

    • Expression systems must support appropriate lipidation pathways

Methodological approaches to ensure proper modification:

  • Expression system selection:

    • Homologous expression in modified A. oryzae strains provides the most authentic PTM profile

    • If heterologous expression is necessary, closely related filamentous fungi are preferred over bacterial or yeast systems

  • PTM analysis protocol:

    • Mass spectrometry-based proteomics to map modification sites

    • Compare PTM profiles between native and recombinant proteins

    • Site-directed mutagenesis of key modification sites to assess functional relevance

  • Optimization strategies:

    • Co-expression of necessary modification enzymes if using heterologous systems

    • Culture condition adjustment to promote desired modifications

    • Engineering of chimeric constructs that retain critical modification sites

By systematically addressing PTM considerations, researchers can ensure that recombinant GPI mannosyltransferase 3 closely mimics the native enzyme's functional properties, leading to more reliable experimental outcomes and more accurate mechanistic insights.

What approaches can resolve contradictory findings regarding substrate specificity and kinetic parameters of GPI mannosyltransferase 3?

Resolving contradictory findings regarding substrate specificity and kinetic parameters of GPI mannosyltransferase 3 requires a systematic approach combining multiple experimental techniques and careful experimental design:

Methodological framework for resolving contradictions:

  • Standardization of enzyme preparations:

    • Implement consistent purification protocols across laboratories

    • Establish quantitative activity assays with reference standards

    • Characterize enzyme preparations for homogeneity and stability

    • Account for potential isoforms or splice variants

  • Comprehensive substrate panel testing:

    • Synthesize or isolate a diverse panel of potential substrates

    • Include both natural and synthetic substrate analogs

    • Test substrate specificity under varying conditions (pH, temperature, ionic strength)

    • Employ computational docking studies to predict interaction patterns

  • Advanced kinetic analysis:

    • Implement progress curve analysis rather than initial rate measurements alone

    • Utilize global fitting approaches to complex kinetic models

    • Account for potential allosteric effects and cooperativity

    • Consider product inhibition and reversibility of reactions

  • Structural biology approaches:

    • Obtain crystal structures or cryo-EM models with bound substrates/analogs

    • Perform HSQC NMR analysis to map substrate binding regions

    • Conduct HDX-MS (hydrogen-deuterium exchange mass spectrometry) to identify conformational changes upon substrate binding

  • Systematic mutagenesis studies:

    • Create targeted mutations in putative catalytic and substrate-binding residues

    • Assess both structural and functional impacts of mutations

    • Develop structure-function relationship models

By integrating data from these complementary approaches, researchers can develop a more nuanced understanding of the enzyme's behavior, reconciling apparent contradictions by identifying conditional factors that influence substrate recognition and catalytic efficiency. This comprehensive approach allows for the development of unified mechanistic models that account for experimental variations.

How can researchers effectively troubleshoot expression and activity issues with recombinant GPI mannosyltransferase 3?

Troubleshooting expression and activity issues with recombinant GPI mannosyltransferase 3 requires a methodical approach addressing multiple potential failure points:

Comprehensive troubleshooting decision tree:

  • Expression level problems:

    Low protein expression:

    • Optimize codon usage for expression host

    • Evaluate promoter strength and induction conditions

    • Consider fusion partners to enhance expression

    • Test different signal sequences for secretion/membrane targeting

    • Examine culture conditions (temperature, media composition, harvest time)

    Expression of insoluble/inactive protein:

    • Reduce expression temperature to slow folding

    • Adjust induction parameters (lower inducer concentration)

    • Co-express molecular chaperones

    • Try detergent screens for membrane protein solubilization

    • Consider refolding protocols if inclusion bodies form

  • Purification challenges:

    Poor affinity tag binding:

    • Ensure tag accessibility (may be buried in protein structure)

    • Try alternative tag positions or types

    • Optimize binding and elution conditions

    • Use denaturing conditions if necessary, followed by refolding

    Protein degradation during purification:

    • Include protease inhibitor cocktails

    • Reduce purification time and temperature

    • Add stabilizing agents (glycerol, specific substrates)

    • Consider on-column refolding for improved stability

  • Activity loss troubleshooting:

    No detectable activity:

    • Verify assay functionality with positive controls

    • Check for inhibitory compounds in buffer components

    • Ensure proper cofactor availability (metal ions, etc.)

    • Try substrate analogs with potentially higher affinity

    • Test activity under various pH and temperature conditions

    Reduced/unstable activity:

    • Optimize storage buffer composition

    • Add stabilizing ligands or substrates

    • Determine half-life under various conditions

    • Consider activity-stabilizing mutations

    • Test the impact of post-translational modifications

  • Experimental approach validation:

    • When persistent issues occur, implement orthogonal approaches:

      • Try cell-free expression systems

      • Consider native purification from the original organism

      • Use microsomal preparations rather than purified protein

      • Develop activity assays in intact cells or membrane preparations

This structured troubleshooting framework enables researchers to systematically identify and address the specific factors limiting successful work with recombinant GPI mannosyltransferase 3, leading to more reliable and reproducible experimental outcomes.

What research gaps currently exist in our understanding of A. oryzae GPI mannosyltransferase 3, and what experimental approaches might address these?

Despite significant advances in understanding fungal GPI biosynthesis, several critical knowledge gaps remain regarding A. oryzae GPI mannosyltransferase 3:

Current research gaps and proposed experimental approaches:

  • Detailed structural characterization:

    • Gap: Lack of high-resolution structural data for A. oryzae GPI mannosyltransferase 3

    • Approach: Apply cryo-EM techniques optimized for membrane proteins, potentially using nanodiscs or amphipols for stabilization; alternatively, pursue X-ray crystallography with stabilizing antibody fragments

  • Comprehensive substrate specificity profile:

    • Gap: Limited understanding of the exact substrate recognition determinants

    • Approach: Develop synthetic GPI precursor libraries with systematic structural variations; employ glycan array technologies to assess binding preferences quantitatively

  • Integration within the GPI biosynthetic pathway:

    • Gap: Incomplete characterization of protein-protein interactions with other GPI biosynthesis components

    • Approach: Apply proximity labeling techniques (BioID, APEX) to identify interaction partners; use genetic interaction mapping to establish functional relationships

  • Regulation of enzymatic activity:

    • Gap: Unknown mechanisms controlling enzyme activity in response to cellular conditions

    • Approach: Investigate post-translational modification patterns using phosphoproteomics and other PTM analyses; study enzyme regulation under various stress conditions

  • Species-specific functions:

    • Gap: Limited understanding of how A. oryzae GPI mannosyltransferase 3 differs functionally from homologs in other fungi

    • Approach: Conduct cross-species complementation studies; perform evolutionary analysis of sequence divergence correlated with functional specialization

These research directions would significantly advance our understanding of fungal GPI biosynthesis while potentially revealing novel applications in biotechnology and biological engineering.

How might emerging gene editing technologies enhance studies of GPI mannosyltransferase 3 function and enable novel applications?

Emerging gene editing technologies offer unprecedented opportunities to advance our understanding of GPI mannosyltransferase 3 and develop innovative applications:

Cutting-edge methodological approaches:

  • CRISPR-Cas9 precision engineering:

    • Generate clean knockout strains with minimal off-target effects

    • Create precise point mutations to test structure-function hypotheses

    • Implement base editing for specific nucleotide modifications

    • Develop conditional systems using CRISPR interference (CRISPRi) or activation (CRISPRa)

    • Design high-throughput CRISPR screens to identify genetic interactions

  • Advanced genome integration techniques:

    • Exploit homology-directed repair for precise gene replacements

    • Implement landing pad systems for consistent gene expression

    • Generate knock-in reporter strains for live monitoring of protein dynamics

    • Create systematic variant libraries through multiplexed editing

  • Synthetic biology applications:

    • Engineer orthogonal GPI biosynthesis pathways with novel specificities

    • Design synthetic glycosylation circuits responsive to external stimuli

    • Develop programmable cell surface display systems

    • Create minimal synthetic GPI biosynthetic pathways

  • Single-cell approaches:

    • Apply single-cell RNA-seq to capture heterogeneous responses to GPI pathway perturbations

    • Implement high-content imaging to correlate genotype with phenotypic outcomes

    • Develop microfluidic platforms for rapid phenotyping of engineered strains

These technological advances enable more sophisticated experimental approaches, including:

  • Development of A. oryzae strains with customized GPI anchors for biotechnological applications

  • Creation of fungal cell factories with enhanced secretion capabilities through GPI pathway engineering

  • Design of biosensors based on GPI-anchored reporter proteins

  • Engineering of filamentous fungi with reduced hyphal aggregation for improved industrial fermentation

The integration of these emerging technologies with traditional biochemical and genetic approaches provides a powerful toolkit for both fundamental research and applied biotechnology development.

What are the implications of recent discoveries about A. oryzae cell wall engineering for optimizing recombinant GPI mannosyltransferase 3 production?

Recent discoveries about A. oryzae cell wall engineering have significant implications for optimizing recombinant protein production, including GPI mannosyltransferase 3:

Key insights and optimization strategies:

  • Cell wall composition engineering:
    Recent research has demonstrated that A. oryzae mutants lacking both α-1,3-glucan and galactosaminogalactan (AGΔ-GAGΔ) exhibit significantly improved recombinant protein production compared to wild-type strains . These findings suggest that targeted modification of cell wall components can dramatically enhance protein yields through several mechanisms:

    • Reduced hyphal aggregation resulting in improved nutrient access

    • Lower culture viscosity enabling better oxygen transfer

    • Enhanced protein secretion through altered cell wall permeability

    For GPI mannosyltransferase 3 production, these engineered strains offer promising platforms for achieving higher yields while maintaining proper folding and post-translational modifications.

  • Rheological optimization for bioreactor cultivation:
    Studies comparing wild-type and cell wall-modified strains revealed that the apparent viscosity of AGΔ-GAGΔ cultures was significantly lower than wild-type cultures, particularly at higher agitation speeds (600 rpm) . This improved rheology facilitates:

    • Better mixing and heat transfer in bioreactors

    • Reduced power requirements for agitation

    • More uniform culture conditions

    • Improved scale-up potential

    These advantages are particularly relevant for membrane proteins like GPI mannosyltransferase 3, which often require carefully controlled cultivation conditions for optimal expression.

  • Integrated bioprocess development:
    Based on these findings, an optimized production strategy should integrate:

    • Cell wall-engineered A. oryzae strains (AGΔ-GAGΔ)

    • Controlled glucose feeding strategies to maintain optimal growth rate

    • Tailored agitation profiles based on culture rheology

    • Process analytical technology (PAT) for real-time monitoring and control

    This integrated approach addresses both biological and engineering challenges in recombinant protein production, potentially enabling significantly improved yields of functionally active GPI mannosyltransferase 3.

  • Future perspectives:
    Emerging research suggests potential for further optimization through:

    • Combined cell wall and secretory pathway engineering

    • Integration of additional genetic modifications targeting protein folding and quality control

    • Development of continuous or semi-continuous cultivation strategies optimized for engineered strains

    • Implementation of computational fluid dynamics modeling to optimize bioreactor design for cell wall-modified strains

These advances in A. oryzae cell wall engineering represent a significant paradigm shift in fungal bioprocess development, with particular relevance for challenging targets like membrane-associated glycosyltransferases .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.