Recombinant Aspergillus oryzae Mitochondrial import inner membrane translocase subunit tim22 (tim22)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tim22; AO090102000295; Mitochondrial import inner membrane translocase subunit tim22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-184
Protein Length
full length protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
tim22
Target Protein Sequence
MNIPGMTTGMAPAGATAGAGFPGAGAGMQGMSEQEQAMVKAMHAAMESCPVKTVISGTMG
FGLGGVFGLFMASMSYDSTFTPQGKAIMDLPWREQVRRGFKDMGSRSWSSAKNFGIVGAL
YSGTECCVEGLRAKNDLSNSVISGCITGGILGAKAGPQAAAAGCAGFAAFSAAIDAYMRM
PSEE
Uniprot No.
Target Background
Function
Recombinant Aspergillus oryzae Mitochondrial Import Inner Membrane Translocase Subunit Tim22 (Tim22) is an essential component of the TIM22 complex. This complex facilitates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Within the TIM22 complex, Tim22 forms a voltage-activated and signal-gated channel. It functions as a twin-pore translocase, utilizing the membrane potential as an external driving force in two voltage-dependent steps.
Database Links
KEGG: aor:AO090102000295
STRING: 5062.CADAORAP00009439
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
