Recombinant Aspergillus oryzae Mitochondrial import inner membrane translocase subunit tim54 (tim54)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
tim54; AO090003001024; Mitochondrial import inner membrane translocase subunit tim54
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-445
Protein Length
full length protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
tim54
Target Protein Sequence
MPNFRLKLPSRNWMIFLTVTGSFTAALVYDRKQKKRAQQKWCDLVAHLSKESLPVDQTRR KLTVFLSAPPGDGLRVAREHFKEYVKPILVAAALDYQVIEGRREGEIRAGLAERIRKFRR KSGEPSTVVEETGIEEVVADAREKIGVVEEPVPKGDLIIGRNTWKEYIRGLHEGWLGPLD PPQPPLSTDVPSPSEGAETNGSPDDTPTAENSEKKEEPEKKDEKPSKPTGPTPAYITPAD YSSQSLPRSLPQSLDGSVPIQFPHILGFLNTPIRIYRYLNQRYLADSVGREVAGIVLAST TRPYSDGSFSTDSELTPAGIDGAPASDNLLGGNYEQKTLLEEEEKDWHKSAHKKDEANPD KEREWVDSVVLDPRIAARMQRYVLSPEDEARSQRIAEGAEYILGEERPTPVPFWQRMWIK YGYGEDEETLKRKPIIGNIDGEDDQ
Uniprot No.

Target Background

Function

Recombinant Aspergillus oryzae Mitochondrial import inner membrane translocase subunit tim54 (tim54) is an essential component of the TIM22 complex. This complex facilitates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. The TIM22 complex functions as a twin-pore translocase, utilizing the membrane potential as its driving force.

Database Links
Protein Families
TIM54 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is the basic structure and topology of Tim54 protein in the mitochondrial membrane?

Basic Research Question

Tim54 is an integral membrane protein located in the mitochondrial inner membrane. Structural analysis indicates it contains one or two potential membrane-spanning segments (approximately at residues 37-54 and 358-386 in the protein sequence). The protein cannot be extracted from mitochondrial membranes using 1.5 M sodium chloride, 0.1 M sodium carbonate, or even 7 M urea treatments, confirming its status as an integral membrane protein .

The carboxyl terminus of Tim54 faces the intermembrane space, as demonstrated through protease protection assays. When mitochondrial outer membranes are disrupted by osmotic shock to form mitoplasts, the carboxyl-terminal region of Tim54 becomes susceptible to proteolytic digestion, indicating its exposure to the intermembrane space . Unlike many matrix-targeted proteins, Tim54 does not appear to contain an amino-terminal cleavable presequence, and no change in molecular mass is observed after import into mitochondria.

How does Tim54 participate in mitochondrial protein import pathways?

Basic Research Question

Tim54 functions as an essential component of a distinct inner membrane protein import complex. It forms a complex with Tim22p that is separate from the previously characterized Tim23p-Tim17p complex. This Tim54p-Tim22p complex specifically mediates the insertion of polytopic proteins into the inner membrane, rather than the translocation of proteins across the membrane into the matrix .

Functional studies using temperature-sensitive tim54-1 mutants demonstrate that Tim54 is required for the insertion of proteins such as the ATP/ADP carrier protein (Aac1p) and Tim23p into the inner membrane, but not for the import of matrix-targeted proteins like Su9-DHFR or Cox4p. This evidence supports the existence of two separate protein import pathways in the mitochondrial inner membrane:

Import PathwayProtein ComponentsPrimary FunctionTarget Proteins
Tim54p-Tim22p complexTim54, Tim22Insertion of proteins into inner membraneAac1p, Tim23p, other polytopic IM proteins
Tim23p-Tim17p complexTim23, Tim17Translocation across inner membraneMatrix-targeted proteins with presequences

This differentiation of function is critical for proper mitochondrial biogenesis and function .

What expression systems are most efficient for producing recombinant Tim54 in A. oryzae?

Basic Research Question

For efficient expression of recombinant Tim54 in A. oryzae, several expression systems can be employed based on recent advances in synthetic biology tools. The Gateway cloning system has proven effective for heterologous expression in A. oryzae. This approach involves cloning the tim54 gene between two attL recombination sites in an entry vector to obtain an entry clone, followed by site-specific recombination with a destination vector containing attR sites using LR Clonase enzyme mixture .

The expression cassette should be designed with a strong A. oryzae promoter such as PamyB (amylase promoter) and a compatible terminator such as TamyB, which have been successfully used for heterologous expression of various proteins in A. oryzae. Selection of appropriate marker genes is also critical for successful transformation and expression:

Selection Marker TypeExamples for A. oryzaeAdvantagesLimitations
Auxotrophic markerspyrG, argB, niaDNo need for antibiotics, reduced metabolic burdenRequires auxotrophic host strain
Dominant selectable markersptrA (pyrithiamine resistance), AosdhB (carbon toxin resistance), Blmb (bleomycin resistance)Can be used in prototrophic strainsDrug costs, potential resistance issues

For multiple genetic manipulations, marker recycling systems using flanking repeat sequences or the Cre/loxP recombination system should be considered to overcome the limited number of selection markers available for A. oryzae .

What are the optimal transformation methods for introducing recombinant Tim54 constructs into A. oryzae?

Basic Research Question

Two primary transformation methods have proven effective for A. oryzae: PEG/CaCl₂-mediated protoplast transformation (PMT) and Agrobacterium tumefaciens-mediated transformation (ATMT). Each has distinct advantages for introducing recombinant Tim54 constructs:

ATMT utilizes A. tumefaciens to insert T-DNA into the fungal host's genome. This method has demonstrated superior conversion efficiency in A. oryzae, particularly when using pyrG as a screening marker. The establishment of pyrG/ptrA double screening systems further enhances the utility of this approach .

For Tim54 expression specifically, ATMT may offer advantages due to its higher transformation efficiency and simpler operation, particularly important when working with membrane proteins like Tim54 that may be challenging to express.

How can researchers generate and characterize tim54 mutants in A. oryzae?

Advanced Research Question

Generating tim54 mutants in A. oryzae requires strategic approaches due to the essential nature of this gene. Researchers should consider:

  • Temperature-sensitive mutants: Following the methodology used for creating tim54-1 mutants in yeast, researchers can employ random mutagenesis followed by screening for conditional growth phenotypes. These temperature-sensitive mutants allow for the study of Tim54 function without lethal consequences .

  • CRISPR/Cas9 genome editing: This technique can be applied to introduce specific mutations in the tim54 gene. The general workflow involves:

    • Designing sgRNAs targeting specific regions of tim54

    • Preparing a repair template with desired mutations

    • Co-transformation of sgRNA, Cas9, and repair template

    • Selection of transformants and confirmation by sequencing

  • Controlled expression systems: Employing inducible promoters to regulate tim54 expression allows for titration of protein levels without complete elimination.

For characterization of mutants, researchers should examine:

  • Growth phenotypes under various conditions (temperature, carbon sources)

  • Mitochondrial morphology and function (membrane potential, respiration)

  • Protein import efficiency for various substrates

  • Interaction with other TIM complex components

A comprehensive approach would involve importing specific substrate proteins into isolated mitochondria from wild-type and mutant strains, then analyzing their localization and function, similar to the techniques used to characterize tim54-1 in yeast .

What methods are most effective for studying Tim54-mediated protein import in isolated A. oryzae mitochondria?

Advanced Research Question

To study Tim54-mediated protein import in isolated A. oryzae mitochondria, researchers should establish a robust in vitro import system. This methodological approach should include:

  • Mitochondrial isolation protocol:

    • Grow A. oryzae under appropriate conditions

    • Prepare spheroplasts using lytic enzymes like Yatalase

    • Disrupt cells with homogenization

    • Isolate intact mitochondria through differential centrifugation

    • Verify mitochondrial integrity using membrane potential-sensitive dyes

  • In vitro import assay setup:

    • Generate ³⁵S-labeled precursor proteins of interest (inner membrane proteins like Aac1p and Tim23p are good candidates)

    • Incubate labeled precursors with isolated mitochondria in import buffer containing ATP and an energy-regenerating system

    • Include controls with uncouplers (CCCP or valinomycin) to dissipate membrane potential

    • After import, treat samples with protease to remove non-imported proteins

    • Analyze by SDS-PAGE and autoradiography

  • Assessment of correct membrane integration:

    • After import, convert mitochondria to mitoplasts by osmotic shock

    • Treat with protease to generate characteristic proteolytic fragments

    • The generation of specific protected fragments (like the 14-kD Tim23p* fragment) indicates correct membrane insertion

For a comprehensive analysis, import experiments should include both matrix-targeted proteins (like Su9-DHFR) and inner membrane proteins (like Aac1p) to confirm the substrate specificity of the Tim54 pathway.

How can protein-protein interactions of Tim54 be effectively studied in A. oryzae?

Advanced Research Question

Studying protein-protein interactions of Tim54 in A. oryzae requires specialized approaches tailored to membrane proteins. A multi-faceted strategy should include:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged Tim54 (e.g., HA-tag as used in yeast studies)

    • Solubilize mitochondria with mild detergents (digitonin or n-dodecyl-β-D-maltoside)

    • Perform immunoprecipitation with antibodies against the tag

    • Analyze co-precipitated proteins by mass spectrometry or Western blotting

    This approach successfully identified the Tim54p-Tim22p interaction in yeast and could be adapted for A. oryzae .

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse Tim54 and potential interacting proteins to complementary fragments of a fluorescent protein

    • Express in A. oryzae using appropriate promoters

    • Analyze interaction by fluorescence microscopy

    • This approach can visualize interactions in their native cellular context

  • Chemical cross-linking coupled with mass spectrometry:

    • Treat isolated mitochondria with membrane-permeable crosslinkers

    • Enrich for Tim54-containing complexes

    • Digest and analyze by LC-MS/MS

    • This method can identify transient or weak interactions

  • Genetic interaction screens:

    • Generate conditional tim54 mutants

    • Perform synthetic genetic array analysis

    • Identify genes whose mutation enhances or suppresses tim54 phenotypes

    The finding that multiple copies of TIM22, but not TIM23 or TIM17, suppress the growth defect of tim54-1 in yeast exemplifies this approach .

These techniques can reveal the composition of the Tim54 complex in A. oryzae and identify potentially novel interacting partners specific to this fungal species.

How does Tim54 contribute to quality control of mitochondrial proteins in A. oryzae?

Advanced Research Question

Tim54's role in mitochondrial protein quality control can be investigated through several methodological approaches:

  • Analysis of non-imported protein fate: When mitochondrial protein import is compromised, including in tim54 mutants, many mitochondrial proteins may be diverted to alternative quality control pathways. Evidence from other systems suggests that non-imported mitochondrial proteins can localize to the nucleus where they undergo proteasome-dependent degradation . To investigate this in A. oryzae:

    • Generate fluorescently tagged mitochondrial protein substrates

    • Express these in wild-type and tim54 mutant backgrounds

    • Use fluorescence microscopy to track protein localization

    • Employ proteasome inhibitors to determine degradation pathways

    • Perform subcellular fractionation to quantify protein distribution

  • Assessing mitochondrial protein turnover rates:

    • Perform pulse-chase experiments with radiolabeled precursors

    • Compare protein half-lives between wild-type and tim54 mutant strains

    • Identify whether specific substrate classes are differentially affected

  • Interaction with other quality control systems:

    • Investigate genetic interactions between tim54 and components of the ubiquitin-proteasome system

    • Examine connections to mitochondrial quality control pathways like mitophagy

This research direction could reveal how A. oryzae Tim54 contributes not only to protein import but also to the broader cellular mechanisms ensuring the fidelity of mitochondrial proteome maintenance.

What evolutionary differences exist between A. oryzae Tim54 and its orthologs in other fungal species?

Advanced Research Question

To investigate evolutionary differences between A. oryzae Tim54 and its orthologs, researchers should employ a comprehensive comparative genomics and structural biology approach:

  • Sequence analysis workflow:

    • Identify Tim54 orthologs across diverse fungal species using BLAST and HMM-based approaches

    • Perform multiple sequence alignments to identify conserved regions and species-specific variations

    • Conduct phylogenetic analysis to map evolutionary relationships

    • Calculate selection pressures (dN/dS ratios) across different protein domains

  • Structural comparison:

    • Generate structural models using AlphaFold or similar prediction tools

    • Compare predicted membrane topology and key functional domains

    • Identify conserved interaction interfaces

  • Functional complementation experiments:

    • Express Tim54 orthologs from different species in A. oryzae tim54 mutants

    • Assess rescue of phenotypes

    • Create chimeric proteins by swapping domains between orthologs to identify functionally critical regions

  • Comparative interactome analysis:

    • Characterize protein interaction networks of Tim54 across species

    • Identify conserved and species-specific interaction partners

This multifaceted approach can reveal how evolutionary pressures have shaped Tim54 function across fungal lineages and potentially identify adaptations unique to A. oryzae given its specialized ecological niche and industrial applications.

How can structural biology approaches be used to elucidate the molecular mechanism of Tim54-mediated protein insertion?

Advanced Research Question

Structural biology approaches to elucidate Tim54's molecular mechanism require specialized techniques for membrane proteins:

  • Cryo-electron microscopy (cryo-EM) strategy:

    • Express and purify Tim54 in complex with its partners (particularly Tim22)

    • Optimize detergent or nanodisc reconstitution conditions

    • Collect high-resolution cryo-EM data

    • Process data using single-particle analysis

    • Generate 3D reconstructions of the complex

  • Cross-linking mass spectrometry (XL-MS) approach:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Enrich for Tim54-containing complexes

    • Identify crosslinked peptides by MS

    • Generate distance restraints for molecular modeling

    • This technique provides spatial relationship data even without high-resolution structures

  • Site-directed mutagenesis strategy:

    • Design mutations at predicted functional sites

    • Assess impact on protein import in vivo and in vitro

    • Combine mutagenesis data with structural information

    • A systematic alanine-scanning approach can identify critical residues

  • Molecular dynamics simulations:

    • Build models of Tim54 in a lipid bilayer environment

    • Simulate interactions with substrate proteins

    • Analyze conformational changes during the import process

The information from these approaches can be integrated to build a comprehensive model of how Tim54 facilitates the insertion of polytopic proteins into the mitochondrial inner membrane, potentially revealing mechanistic differences from the Tim23-Tim17 translocase that mediates matrix protein import .

What are the main challenges in expressing functional recombinant Tim54 in A. oryzae and how can they be overcome?

Basic Research Question

Expressing functional membrane proteins like Tim54 presents several technical challenges:

  • Low expression levels: Membrane proteins often express poorly due to cellular toxicity and folding challenges. This can be addressed by:

    • Using tightly controlled inducible promoters like PamyB (amylase promoter)

    • Optimizing codon usage for A. oryzae

    • Including fusion tags that enhance folding (e.g., MBP or thioredoxin)

    • Performing expression at lower temperatures to improve folding

  • Proper subcellular targeting: Tim54 must correctly localize to mitochondria. Researchers should:

    • Retain native mitochondrial targeting signals

    • Verify localization using fluorescent protein fusions

    • Perform subcellular fractionation to confirm mitochondrial enrichment, similar to the approach used in yeast studies

  • Selection marker limitations: A. oryzae has limited selection markers available. Solutions include:

    • Implementing marker recycling systems using repeat sequences

    • Utilizing the Cre/loxP system for marker reuse

    • Developing new markers like the recently identified pyridine thiamine resistance marker gene (thil)

  • Transformation efficiency: To improve transformation efficiency:

    • Consider ATMT instead of PMT for higher efficiency

    • Optimize protoplast preparation for PMT by adjusting enzyme concentrations and incubation times

    • Use multiple screening markers like pyrG/ptrA for more efficient selection

Addressing these challenges systematically will improve the likelihood of successful functional Tim54 expression in A. oryzae.

How might Tim54 function be leveraged for biotechnological applications in A. oryzae?

Advanced Research Question

Understanding and manipulating Tim54 function could be leveraged for several biotechnological applications in A. oryzae:

  • Improved heterologous protein production:

    • Engineering the Tim54-Tim22 pathway could enhance mitochondrial capacity for energy production

    • This could support higher protein production loads without compromising cellular energy balance

    • A systematic approach would involve:

      • Controlled upregulation of Tim54 and associated import components

      • Monitoring effects on mitochondrial function and protein production

      • Optimizing the balance between import pathways

  • Stress tolerance engineering:

    • Mitochondrial function is critical for cellular stress responses

    • Modulating Tim54 activity could enhance A. oryzae resilience under industrial fermentation conditions

    • This approach requires:

      • Characterizing Tim54 expression and function under various stress conditions

      • Identifying rate-limiting steps in the import pathway

      • Engineering stress-responsive regulation of the Tim54 pathway

  • Synthetic biology applications:

    • The Tim54 pathway could be manipulated to create synthetic organelle-targeting systems

    • This would enable compartmentalization of engineered metabolic pathways

    • Implementation would involve:

      • Identifying minimal components of the Tim54-mediated import system

      • Engineering synthetic targeting sequences optimized for specific cargo proteins

      • Developing modular expression cassettes for pathway engineering

These applications represent frontier areas where fundamental understanding of Tim54 function could translate into biotechnological innovations specifically tailored to A. oryzae's industrial applications.

What are the implications of Tim54 research for understanding mitochondrial disease mechanisms?

Advanced Research Question

While A. oryzae is not a direct model for human disease, comparative studies of Tim54 function across species can provide valuable insights into fundamental mechanisms relevant to mitochondrial diseases:

  • Comparative analysis of mitochondrial import defects:

    • Many mitochondrial diseases involve protein import deficiencies

    • The distinct roles of different import pathways (Tim54-Tim22 versus Tim23-Tim17) in substrate specificity have direct parallels in human pathology

    • Research approach should include:

      • Systematic comparison of fungal Tim54 with human homologs

      • Identification of conserved mechanisms and species-specific adaptations

      • Testing whether pathogenic mutations in human import components affect conserved functions

  • Quality control mechanisms:

    • Tim54 research illuminates how cells handle non-imported mitochondrial proteins

    • The nuclear-based quality control pathway for non-imported mitochondrial proteins may have parallels in human cells

    • Investigation strategy:

      • Characterize the fate of non-imported proteins in tim54 mutants

      • Identify quality control components that recognize mislocalized mitochondrial proteins

      • Compare mechanisms across species to identify conserved principles

  • Therapeutic strategy development:

    • Understanding the fundamental mechanisms of Tim54-mediated import

    • Identifying small molecules that modulate specific import pathways

    • Approach would involve:

      • Developing high-throughput screens for Tim54 pathway activity

      • Testing compounds that restore function in import-deficient models

      • Examining translation potential to higher eukaryotic systems

This research direction connects basic science on fungal mitochondrial import to broader biomedical applications, potentially informing therapeutic approaches for mitochondrial disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.