Recombinant Aspergillus oryzae Mitochondrial intermembrane space import and assembly protein 40 (mia40)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mia40

Recombinant Aspergillus oryzae Mia40 is a bioengineered version of the mitochondrial intermembrane space (IMS) protein Mia40, expressed in Escherichia coli with an N-terminal His-tag for purification . This protein (UniProt ID: Q2USJ2) spans amino acids 25–187 and is critical for importing and assembling IMS proteins, particularly those containing conserved cysteine motifs (e.g., small Tim proteins) . Its recombinant form has been widely used to study mitochondrial protein biogenesis and redox-dependent pathways.

Expression and Purity

ParameterDetails
Expression HostE. coli (plasmid-based)
Purity>95% (via Ni-NTA chromatography)
StorageTris-based buffer with 50% glycerol at -20°C

Protein Import via the MIA Pathway

Mia40 functions as a trans-site receptor, binding substrates via hydrophobic interactions and driving their translocation across the outer mitochondrial membrane (OMM) . Key steps include:

  1. Substrate recognition: Hydrophobic pockets bind unfolded precursor proteins.

  2. Disulfide bond formation: The CPC motif oxidizes cysteines, stabilizing substrates in the IMS .

  3. Interaction with Erv1: Mia40 partners with the thiol oxidase Erv1 to relay electrons, completing the disulfide relay system .

Functional Insights from Mutant Studies

Mutation TypeEffectExperimental Evidence
Oxidase-deficient (CPC motif)Loss of viability; partial rescue with diamide Yeast mia40 mutants
Binding-deficient (hydrophobic pocket)Impaired import; substrates accumulate at Mia40 mia40-3 mutants

Role in Mitochondrial Protein Assembly

Mia40 is essential for importing small Tim proteins (e.g., Tim9, Tim10) and Cox proteins (Cox17, Cox19), which form complexes critical for mitochondrial function . Its Fe–S cluster (bound via CPC motifs) may regulate redox-dependent processes, though its role remains under investigation .

Dual Import Pathways

PathwayCharacteristics
Presequence pathwayFull-length Mia40 uses N-terminal presequence for matrix targeting
MIA pathwayMia40 core (C-terminal domain) imports via Mia40/Erv1-dependent mechanism

Impact on Proteostasis

Overexpression of Mia40 in Saccharomyces cerevisiae suppresses cytosolic polyglutamine (polyQ) aggregation by competing for chaperones, highlighting its role in cellular stress responses .

Applications and Significance

  1. Research Tool: Used to study mitochondrial protein biogenesis, redox signaling, and Fe–S cluster biology .

  2. Therapeutic Potential: Mia40 overexpression may mitigate proteotoxic stress in neurodegenerative diseases .

  3. Biotechnological Use: His-tagged Mia40 facilitates structural studies (e.g., X-ray crystallography) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your application.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mia40; tim40; AO090005000405; Mitochondrial intermembrane space import and assembly protein 40; Mitochondrial import inner membrane translocase TIM40
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-187
Protein Length
Full Length of Mature Protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
mia40
Target Protein Sequence
ISTAPAESKPRSWKNTAVRLGLAAGAIYYYNTSNVFAENPSFSLNNQLKKNSAEEPLPTL DSIKPRIREERESAAPKPNAEQAPAQELPFGEGAVKSPQELEEEAGQEAAFNPETGEINW DCPCLGGMAHGPCGEEFKAAFSCFVYSEEEPKGMDCIEKFKCV
Uniprot No.

Target Background

Function

MIA40 is essential for the import and folding of small, cysteine-containing proteins (small Tims) within the mitochondrial intermembrane space (IMS). It functions in a redox cycle with ERV1, utilizing a disulfide relay system. Precursor proteins destined for the IMS are translocated in their reduced state into the mitochondria. Oxidized MIA40 forms a transient intermolecular disulfide bond with the reduced precursor protein, oxidizing the precursor. This oxidized precursor, now containing an intramolecular disulfide bond, subsequently folds correctly within the IMS.

Database Links
Subcellular Location
Mitochondrion inner membrane; Single-pass type II membrane protein; Intermembrane side.

Q&A

What is Mia40 and what is its fundamental function in mitochondria?

Mia40 (Mitochondrial intermembrane space import and assembly protein 40) is an essential protein located in the mitochondrial intermembrane space (IMS) that serves as the central component of the mitochondrial IMS protein import and assembly machinery. Functionally, Mia40 acts as a receptor-like protein that binds to incoming precursor proteins as they cross the outer mitochondrial membrane, facilitating their complete translocation into the IMS . Additionally, Mia40 possesses oxidoreductase activity, catalyzing the formation of disulfide bonds in substrate proteins, which is crucial for their proper folding and retention in the IMS .

The protein operates as part of the Mitochondrial Intermembrane space Assembly (MIA) pathway, which is dedicated to the oxidation-dependent import of small cysteine-rich proteins . Mia40's essentiality for cell viability in yeast highlights its critical function in mitochondrial biogenesis .

How does the Mia40-dependent protein import pathway operate mechanistically?

The Mia40-dependent import pathway operates through a sequential mechanism:

  • Substrate translocation initiation: Substrate proteins with internal targeting signals (ITS/MISS) enter the IMS through the TOM complex in the outer membrane in a loosely folded conformation .

  • Receptor-substrate recognition: Mia40 recognizes and binds to the hydrophobic MISS/ITS signal in incoming precursor proteins via its substrate-binding pocket .

  • Substrate entrapment: This binding event is sufficient to trap the substrate in the IMS through what recent evidence suggests is a "holding trap" rather than a "folding trap" mechanism .

  • Oxidative folding: The redox-active CPC motif of Mia40 catalyzes the formation of disulfide bonds in the substrate, transferring disulfides to specific cysteine residues .

  • Substrate release and Mia40 recycling: The oxidized substrate is released from Mia40, which is subsequently re-oxidized by the sulfhydryl oxidase Erv1, completing the disulfide relay system .

Importantly, recent research has revealed that the substrate-binding function of Mia40 is both necessary and sufficient for protein import, while its oxidoreductase activity may be dispensable for the actual translocation event but essential for subsequent folding and stability of substrates .

What experimental approaches are most effective for studying A. oryzae Mia40 function?

Several complementary experimental approaches have proven effective for studying Mia40 function:

  • Genetic manipulation: Creating mutant versions of Mia40 (e.g., Mia40-SPS, Mia40-FE, Mia40-STOP) to study specific domains and functions . For A. oryzae specifically, Agrobacterium-mediated transformation (AMT) has been established as an effective method for genetic transformation .

  • In vitro import assays: Using isolated mitochondria to monitor the import of radiolabeled precursor proteins. This approach typically includes:

    • Synthesis of radiolabeled precursor proteins in reticulocyte lysate

    • Incubation with isolated mitochondria

    • Analysis of import by protease protection assays and SDS-PAGE

  • Co-immunoprecipitation: To identify and characterize physical interactions between Mia40 and its substrate proteins or other components of the import machinery .

  • Redox state analysis: Using alkylating agents like mmPEG24 or mmPEG12 that react with free thiols, causing a mobility shift in SDS-PAGE to monitor the redox state of cysteines in Mia40 and its substrates .

  • Pulse-chase experiments: To follow the oxidation kinetics of newly synthesized proteins and assess Mia40's role in this process .

For A. oryzae specifically, researchers must contend with technical challenges including tough cell walls and high drug resistance, which have limited functional genomic characterization studies .

What are the typical substrate proteins of Mia40 and how are they recognized?

Mia40 interacts with a diverse range of substrate proteins:

Substrate TypeExamplesCysteine MotifFunction
Small Tim proteinsTim9, Tim10Twin CX₃CChaperones for mitochondrial membrane proteins
Copper chaperonesCox17, Cox19Twin CX₉CCopper incorporation in cytochrome c oxidase
Non-classical substratesMix23CX₁₃C/CX₁₄CVarious functions
Membrane proteinsTim22N/ACore component of TIM22 translocase
Moonlighting proteinsTRIAP1Twin CX₉CPhospholipid trafficking/apoptosis regulation

Classical Mia40 substrates typically share several characteristics:

  • Small size (8-22 kDa)

  • Presence of a hydrophobic intermembrane space targeting signal (ITS)

  • Twin CXₙC motifs (where n is typically 3 or 9)

Substrate recognition occurs through specific hydrophobic interactions between the ITS/MISS signal in substrates and the substrate-binding pocket of Mia40. This interaction positions specific cysteine residues for oxidation by the CPC motif of Mia40 .

Recent research has expanded the range of Mia40 substrates beyond small IMS proteins to include membrane proteins like Tim22, suggesting a broader role in mitochondrial biogenesis than previously recognized .

How does the recombinant A. oryzae Mia40 protein compare with native Mia40 in experimental applications?

Recombinant A. oryzae Mia40 protein is commercially available as a research tool with the following specifications:

  • Expression region: Amino acids 25-187 of the full-length protein

  • Storage recommendations: -20°C in Tris-based buffer with 50% glycerol

  • Gene name: mia40 (synonym: tim40)

  • ORF name: AO090005000405

The search results don't provide direct comparisons between recombinant and native A. oryzae Mia40 in experimental systems. This represents a knowledge gap in the current literature that researchers should consider when designing experiments. Important considerations when using recombinant Mia40 include:

  • Potential structural differences between recombinant and native forms

  • Possible effects of purification tags on function

  • Necessity for proper folding and disulfide bond formation in the recombinant protein

  • Need for experimental validation of activity prior to use in complex assays

When using recombinant Mia40 in functional studies, researchers should consider performing parallel experiments with native mitochondrial preparations as controls when possible.

How can researchers differentiate between the chaperone and oxidoreductase functions of Mia40?

Distinguishing between Mia40's dual functions as a chaperone and an oxidoreductase requires sophisticated experimental approaches:

  • Targeted mutation strategy: Generate Mia40 variants with specific functional deficiencies:

    • Mia40-SPS mutant: CPC motif mutated to SPS, eliminating oxidoreductase activity while preserving binding function

    • Mia40-FE mutant: Replacement of conserved phenylalanine residues in the binding pocket with glutamate, disrupting substrate binding

    • Mia40-STOP mutant: Complete removal of the substrate-binding domain while retaining the CPC motif

  • Chemical complementation approach: Use chemical oxidants (e.g., diamide) to partially rescue oxidase-deficient Mia40 mutants, allowing assessment of oxidation-independent functions .

  • Combined analytical techniques:

    • Non-reducing vs. reducing SDS-PAGE to identify disulfide-bonded intermediates

    • mmPEG alkylation to track formation of disulfide bonds

    • Co-immunoprecipitation under different redox conditions to assess binding independent of oxidation

  • Kinetic analysis: Pulse-chase experiments comparing wild-type and mutant Mia40 can reveal the relative contributions of binding and oxidation to substrate import and folding kinetics .

This experimental framework has revealed that Mia40 predominantly functions as a "trans-site receptor" that binds incoming proteins via hydrophobic interactions, driving protein translocation across the outer membrane primarily through a "holding trap" rather than a "folding trap" mechanism .

What are the critical methodological considerations when studying the folding intermediates of Mia40-dependent substrates?

Studying folding intermediates in the Mia40 pathway presents unique challenges that require specialized methodological approaches:

  • Trapping transient intermediates:

    • Use of cysteine-mutated forms of substrates and Mia40 to arrest specific intermediate states

    • Temperature-sensitive mutants (e.g., mia40-3, mia40-4) to slow down the import process

    • Quick-freezing techniques to capture short-lived species

  • Distinguishing folding stages:

    • In-cell NMR analysis to monitor the unfolded state of substrates in the cytosol

    • Sequential tracking of disulfide bond formation using site-specific cysteine labeling

    • Correlation of structural changes with specific oxidation events

  • Controlling experimental redox environment:

    • Careful buffer preparation to maintain defined redox potentials

    • Use of appropriate reducing and oxidizing agents (DTT, GSH/GSSG, diamide)

    • Prevention of artifactual oxidation during sample preparation

  • Addressing organism-specific challenges:

    • For A. oryzae, consideration of cell wall barriers for in vivo studies

    • Development of appropriate mitochondrial isolation protocols

    • Adaptation of genetic tools for the specific organism

Research has revealed that Mia40-dependent folding involves two consecutive induced folding steps: first, Mia40 functions as a molecular chaperone assisting α-helical folding of the internal targeting signal; subsequently, this folded segment triggers complete folding of the rest of the substrate in a Mia40-independent manner .

How does the Mia40 system interact with other mitochondrial pathways, and what are the implications for mitochondrial disease research?

The Mia40 system is integrated with multiple mitochondrial pathways, with significant implications for disease research:

  • Interaction with apoptosis regulation:

    • Apoptosis-inducing factor (AIF) physically interacts with MIA40/CHCHD4

    • AIF deficiency correlates with decreased MIA40 protein levels

    • MIA40 overexpression can counteract the loss of respiratory subunits in AIF-deficient cells

  • Connection to respiratory chain function:

    • Mia40 is required for the import of proteins essential for respiratory complex assembly

    • Disruption of the MIA pathway affects oxidative phosphorylation capacity

    • MIA40 reduction contributes to respiratory defects in AIF-related mitochondrial disorders

  • Integration with redox homeostasis networks:

    • Mitochondrial redox processes linked to iron-sulfur cluster biogenesis and calcium homeostasis converge at the MIA machinery

    • NAD(H) levels influence the MIA pathway through AIF

    • The Mia40 substrate TRIAP1 connects to p53-dependent cell survival pathways

These interactions have significant implications for disease research:

  • Therapeutic potential: "The MIA machinery and several of its interactors and substrates are linked to a variety of common human diseases connected to mitochondrial dysfunction highlighting the potential of redox processes in the IMS as a promising new target for developing new treatments" .

  • Disease mechanisms: Mia40 dysfunction may contribute to neurodegenerative disorders, cancer (through TRIAP1 dysregulation), and metabolic diseases .

  • Biomarker development: Components of the MIA pathway could serve as potential biomarkers for mitochondrial dysfunction in various pathological conditions.

What contradictory findings exist in the literature regarding Mia40 function, and how might these be reconciled?

Several apparent contradictions in the literature highlight evolving understanding of Mia40 function:

  • Mechanistic model disputes:

    • Traditional "folding trap" hypothesis: Disulfide bond formation drives import by locking proteins in folded conformations, trapping them in the IMS

    • Newer "holding trap" model: Mia40's substrate-binding function is sufficient for import, while oxidation primarily contributes to substrate stability

    Reconciliation: Both mechanisms may operate with different relative importance depending on the substrate and organism. Experimental evidence with the Mia40-SPS mutant strongly supports the "holding trap" model as the primary mechanism .

  • Substrate specificity controversies:

    • Classical view: Mia40 specifically targets small IMS proteins with twin CXₙC motifs

    • Expanded role: Mia40 also mediates import and oxidation of membrane proteins (Tim22) and proteins with non-canonical cysteine patterns

    Reconciliation: Mia40 likely has broader substrate specificity than initially thought, with recognition features extending beyond the classical twin CXₙC motifs.

  • Functional differences across species:

    • S. cerevisiae Mia40 lacks the regulatory N-terminus found in higher metazoans

    • Human CHCHD4 (Mia40 homolog) is reported to have additional regulatory mechanisms

    Reconciliation: The core function of Mia40 is conserved, but regulatory mechanisms have evolved differently across species, potentially reflecting different metabolic requirements and complexity.

  • Import requirements discrepancies:

    • Some studies suggest absolute requirement for oxidation during import

    • Others demonstrate import can occur in oxidase-deficient mutants

    Reconciliation: Import (translocation) and stable folding (retention) are distinct processes with different requirements; import can occur without oxidation, but long-term stability often requires disulfide formation.

These contradictions highlight the importance of specifying experimental conditions and organism when interpreting Mia40 research findings, as well as the need for further studies on organism-specific functions of Mia40, particularly in A. oryzae.

What is the optimal protocol for assessing Mia40-substrate interactions using recombinant proteins?

Based on the research literature, the following protocol is recommended for analyzing Mia40-substrate interactions with recombinant proteins:

Materials:

  • Recombinant A. oryzae Mia40 (stored in Tris-based buffer with 50% glycerol at -20°C)

  • Purified substrate protein or in vitro translated radiolabeled substrate

  • Import buffer (250 mM sucrose, 80 mM KCl, 5 mM MgCl₂, 10 mM MOPS-KOH, pH 7.2)

  • Alkylating agents (mmPEG24 or mmPEG12)

Protocol:

  • Preparation of components:

    • Dilute recombinant Mia40 to working concentration (typically 1-5 μM) in import buffer

    • If using radiolabeled substrates, synthesize in reticulocyte lysate following standard protocols

    • Prepare reduced and oxidized substrate controls for comparison

  • Interaction assay:

    • Mix Mia40 and substrate in import buffer at appropriate molar ratios (typically 1:1 to 1:5)

    • Incubate at 25°C for 5-30 minutes to allow complex formation

    • For time-course studies, remove aliquots at predetermined intervals

  • Analysis of complex formation:

    • Non-covalent interactions: Co-immunoprecipitation using anti-Mia40 antibodies

    • Disulfide-linked intermediates: Non-reducing SDS-PAGE

    • Kinetic analysis: Quench reactions with TCA at different time points

  • Redox state analysis:

    • Precipitate proteins with TCA to preserve redox state

    • Resuspend in buffer containing alkylating agent (mmPEG24)

    • Analyze by SDS-PAGE to detect mobility shifts indicating free thiols

  • Controls and validation:

    • Include oxidized and reduced substrate controls

    • Use Mia40 mutants (Mia40-SPS, Mia40-FE) to differentiate binding from oxidation

    • Compare results with native mitochondrial preparations when possible

This protocol enables assessment of both the binding affinity and oxidoreductase activity of Mia40 toward various substrates, allowing researchers to dissect the multi-step process of Mia40-mediated protein import and folding.

How can researchers effectively study species-specific differences in Mia40 function between S. cerevisiae and A. oryzae?

To effectively study species-specific differences in Mia40 function between S. cerevisiae and A. oryzae, researchers can employ the following strategies:

  • Comparative sequence-structure analysis:

    • Perform detailed sequence alignments of Mia40 from both species

    • Identify conserved and divergent functional domains

    • Use structural prediction tools to model potential differences in protein folding

    • Compare substrate binding regions and redox-active sites

  • Heterologous expression studies:

    • Express A. oryzae Mia40 in S. cerevisiae mia40 mutants to assess functional complementation

    • Test complementation under various growth conditions to reveal condition-specific differences

    • Analyze the ability of each species' Mia40 to recognize and import the other species' substrates

  • Organism-specific technical adaptations:

    • For A. oryzae:

      • Develop specialized transformation protocols optimized for its tough cell walls

      • Use AMT with pyrG auxotrophic marker and fluorescent reporter genes

      • Establish dual selection marker systems for improved transformation efficiency

    • For S. cerevisiae:

      • Employ well-established genetic tools like temperature-sensitive mutants (mia40-3, mia40-4)

      • Utilize regulatable promoters (e.g., GAL promoter) for controlled expression studies

  • Comparative substrate profiling:

    • Identify and compare the repertoire of Mia40-dependent proteins in both organisms

    • Analyze differences in recognition motifs and oxidation patterns

    • Compare the kinetics of substrate oxidation and release

  • Functional contextual studies:

    • Investigate differences in interactions with other mitochondrial systems

    • Compare the roles of Mia40 in response to various stresses in both organisms

    • Examine metabolic adaptations that might influence Mia40 function

This multi-faceted approach will help elucidate both shared and species-specific aspects of Mia40 function, providing insights into how this essential protein has evolved to meet the specific requirements of different fungal species.

How might the study of A. oryzae Mia40 contribute to biotechnological applications?

The study of A. oryzae Mia40 offers several promising biotechnological applications:

As research on A. oryzae Mia40 progresses, these applications could significantly impact various biotechnological sectors, particularly those involving protein production, enzyme engineering, and metabolic optimization.

What are the most promising research directions for understanding the evolutionary adaptations of the Mia40 system?

Several promising research directions could advance our understanding of the evolutionary adaptations of the Mia40 system:

  • Comparative genomics and phylogenetic analysis:

    • Comprehensive comparison of Mia40 sequences across diverse eukaryotic lineages

    • Identification of lineage-specific adaptations and conserved functional elements

    • Correlation of Mia40 structural variations with mitochondrial complexity

  • Structure-function relationship studies:

    • Investigation of how structural differences between fungal Mia40 (membrane-anchored) and metazoan CHCHD4 (soluble) relate to functional adaptations

    • Analysis of how the presence/absence of regulatory domains affects Mia40 function across species

    • Determination of species-specific substrate recognition mechanisms

  • Regulatory network evolution:

    • Exploration of how Mia40's interactions with other proteins (like AIF) have evolved

    • Analysis of redox regulation mechanisms across different organisms

    • Investigation of how environmental adaptations have shaped Mia40 function

  • Substrate co-evolution:

    • Study of how Mia40 substrates have co-evolved with the import machinery

    • Analysis of cysteine motif variations and their relationship to Mia40 recognition

    • Investigation of how novel substrate-Mia40 interactions emerged during evolution

  • Functional adaptation studies:

    • Examination of how Mia40 function has adapted to different cellular environments

    • Investigation of species-specific responses to redox changes and stress conditions

    • Analysis of how Mia40's dual functions (binding and oxidation) have been balanced through evolution

This research would provide valuable insights into how this essential protein import system has evolved and adapted to diverse organismal requirements, potentially revealing principles of mitochondrial evolution and protein import pathway development that could inform both basic science and applications in synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.