Recombinant Aspergillus oryzae Mitochondrial thiamine pyrophosphate carrier 1 (tpc1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference for your application.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
tpc1; AO090012000416; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
tpc1
Target Protein Sequence
MSAGGEHLKDEGTRRQVVLAGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPTSHQNIKG PVYKGTLPTIRSIVREEGITGLWKGNIPAELMYVCYGAIQFAAYRTTTQALSQLDPYRLP PPAESFVAGATAGGLATASTYPLDLLRTRFAAQGTERVYTSLYASVRDIAQNEGPKGFFR GCSAAVGQIVPYMGLFFATYESLRPVMSGLHDLPFGSGDAAAGVVASVLAKTGVFPLDLV RKRLQVQGPTRSKYVHRNIPEYQGVYNTMAMIVRTQGMRGLYRGLTVSLFKAAPASAVTM WTYEKSLHYLRELEVASE
Uniprot No.

Target Background

Function
Mitochondrial transporter responsible for mediating the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the primary function of mitochondrial thiamine pyrophosphate carrier 1 (tpc1) in Aspergillus oryzae?

Mitochondrial thiamine pyrophosphate carrier 1 (tpc1) in A. oryzae serves as a specialized transporter that facilitates the movement of thiamine pyrophosphate (ThPP) across the mitochondrial membrane. This function is essential because ThPP is a crucial cofactor for several key mitochondrial enzymes involved in carbon metabolism, including pyruvate dehydrogenase and α-ketoglutarate dehydrogenase complexes . Unlike some other mitochondrial carriers, tpc1 can catalyze both uniport (single-directional transport) and exchange reactions of ThPP . This protein is structurally distinct from the human deoxynucleotide carrier (DNC), with only about 25% sequence identity, indicating its unique evolutionary adaptation in fungal species .

How does the structure of A. oryzae tpc1 compare with homologs in other fungal species?

A. oryzae tpc1 consists of 318 amino acids with characteristic transmembrane domains forming a channel for ThPP transport . Comparative analysis with other fungal homologs reveals both conserved and variable regions:

SpeciesProtein LengthUnique FeaturesPrimary Function
A. oryzae318 aaEfficient ThPP/ThMP transportMitochondrial ThPP carrier
M. oryzae327 aaContains Zn(II)2Cys6 domainTranscriptional regulator + ThPP carrier
S. cerevisiaeSimilar sizeLess substrate versatilityThPP transport only

The M. oryzae homolog has evolved additional functionality as a transcription factor that regulates polarized growth and pathogenicity , representing a significant functional divergence while maintaining the core transport capability. Sequence comparison indicates that while transmembrane domains remain relatively conserved to maintain transport function, other regions have evolved to accommodate species-specific adaptations .

What is the standard protocol for recombinant expression of A. oryzae tpc1?

The standard protocol for recombinant expression of A. oryzae tpc1 typically involves the following methodology:

  • Gene Cloning: The full-length tpc1 gene (1-318aa) is amplified from A. oryzae genomic DNA using PCR with specific primers.

  • Vector Construction: The amplified gene is cloned into an E. coli expression vector, typically with an N-terminal His-tag for purification purposes .

  • Transformation and Expression: The recombinant vector is transformed into an E. coli expression strain (typically BL21 derivatives), and protein expression is induced under optimized conditions .

  • Purification Process:

    • Cells are lysed, and the recombinant protein is purified using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Further purification may involve ion exchange or size exclusion chromatography

    • Final purity is typically greater than 90% as determined by SDS-PAGE

  • Storage: The purified protein is formulated in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, and can be lyophilized for long-term storage .

This approach yields functional tpc1, suitable for structural and biochemical studies. Alternative expression systems such as Pichia pastoris have also been successfully employed for other Aspergillus proteins and may offer advantages for tpc1 expression in certain research contexts .

What methods can be used to investigate the transport activity of recombinant A. oryzae tpc1?

To rigorously characterize the transport activity of recombinant A. oryzae tpc1, researchers can employ several complementary methodologies:

  • Liposome Reconstitution Assays:

    • Purified recombinant tpc1 is reconstituted into phospholipid vesicles

    • Transport activity is measured by monitoring the uptake of radiolabeled ThPP

    • This approach allows determination of kinetic parameters (Km, Vmax) and substrate specificity

  • Yeast Complementation Studies:

    • Expression of A. oryzae tpc1 in S. cerevisiae tpc1Δ mutants

    • Functional complementation is assessed by measuring:

      • Restoration of growth on fermentative carbon sources

      • Recovery of intramitochondrial ThPP levels

      • Rescue of ThPP-dependent enzyme activities

  • Biophysical Characterization:

    • Isothermal titration calorimetry to determine ThPP binding affinity

    • Circular dichroism to assess protein folding and stability

    • Fluorescence-based assays using labeled substrates or protein

  • Transport Kinetics Analysis:

    • Measurement of transport rates under various conditions (pH, temperature, ion gradients)

    • Determination of inhibition profiles with potential competitive substrates

    • Comparison with transport characteristics of mutant variants

These techniques collectively provide comprehensive insights into the functionality and mechanistic aspects of tpc1-mediated ThPP transport.

What phenotypes are observed when tpc1 is deleted or mutated in A. oryzae?

Deletion or mutation of tpc1 in A. oryzae results in several significant phenotypic changes that highlight its essential role in fungal metabolism:

  • Metabolic Deficiencies:

    • Decreased intramitochondrial ThPP levels

    • Reduced activities of ThPP-dependent enzymes, particularly alpha-ketoglutarate dehydrogenase and pyruvate dehydrogenase

    • Altered carbon metabolism

  • Growth Abnormalities:

    • Development of thiamine auxotrophy specifically on fermentative carbon sources

    • Normal growth on non-fermentative carbon sources, suggesting an alternative ThPP transport mechanism under these conditions

    • Growth defects can be partially rescued by supplementation with valine and isoleucine, indicating a specific effect on amino acid metabolism

  • Expression Analysis:

    • Unlike genes involved in thiamine biosynthesis (such as thi4, thi5, and thi6), tpc1 expression is not repressed by thiamine, supporting its role in transport rather than biosynthesis

    • The tpc1 deletion phenotype persists even in the presence of thiamine in the medium

These observations confirm that tpc1 functions specifically in ThPP transport rather than thiamine biosynthesis and plays a crucial role in maintaining proper mitochondrial metabolism, particularly under fermentative growth conditions.

How does tpc1 affect mitochondrial function and broader cellular metabolism?

Tpc1 influences multiple aspects of mitochondrial function and cellular metabolism through its pivotal role in ThPP transport:

  • Mitochondrial Energy Production:

    • By ensuring adequate ThPP levels in mitochondria, tpc1 supports the proper functioning of key TCA cycle enzymes

    • This directly impacts ATP production through oxidative phosphorylation

    • Disruption of tpc1 function can lead to metabolic rewiring to compensate for reduced mitochondrial function

  • Amino Acid Metabolism:

    • The observation that valine and isoleucine supplementation partially rescues tpc1Δ growth defects indicates a specific impact on branched-chain amino acid metabolism

    • This connection likely results from the role of ThPP-dependent enzymes in amino acid biosynthetic pathways

  • Redox Balance:

    • In some fungal species, tpc1-related proteins have been linked to reactive oxygen species (ROS) regulation

    • In A. oryzae specifically, mitochondrial ROS production is known to affect various cellular processes, and tpc1's role in mitochondrial function may influence redox homeostasis

  • Metabolic Adaptation:

    • Under non-fermentative growth conditions, A. oryzae can compensate for tpc1 deficiency through alternative ThPP transport mechanisms

    • This metabolic flexibility demonstrates the importance of maintaining appropriate mitochondrial ThPP levels under different growth conditions

The extensive impact of tpc1 on these interconnected metabolic processes highlights its significance in maintaining cellular homeostasis in A. oryzae.

How does A. oryzae tpc1 differ from similar proteins in pathogenic fungi like Magnaporthe oryzae?

While A. oryzae and M. oryzae tpc1 proteins share the fundamental function of thiamine pyrophosphate transport, they exhibit significant differences that reflect their distinct ecological niches:

  • Functional Divergence:

    • M. oryzae Tpc1 has evolved additional functionality as a Zn(II)2Cys6 transcriptional regulator

    • It regulates invasive polarized growth, cytoskeletal dynamics, and infection-associated autophagy

    • A. oryzae Tpc1 appears primarily focused on metabolic functions related to ThPP transport

  • Structural Comparison:

    • M. oryzae Tpc1 (327aa) is slightly longer than A. oryzae Tpc1 (318aa)

    • Sequence analysis reveals domain structures adapted to their respective functions

    • Both maintain the core transmembrane domains essential for transport function

  • Role in Pathogenicity:

    • In M. oryzae, Tpc1 is essential for plant tissue colonization, controlling appressorium development and function

    • Tpc1-deficient M. oryzae mutants show severe defects in conidiogenesis, infection-associated autophagy, and glycogen/lipid metabolism

    • A. oryzae, being non-pathogenic, has not evolved these specialized pathogenicity-related functions

This functional divergence highlights how homologous proteins can adapt to serve specialized roles while maintaining core ancestral functions, demonstrating the evolutionary versatility of mitochondrial carrier proteins in fungi.

What can be inferred about the evolution of tpc1 across different fungal species?

Evolutionary analysis of tpc1 across fungal species reveals several important patterns:

  • Phylogenetic Relationships:

    • Mitochondrial genome analysis shows that A. oryzae tpc1 forms a distinct clade with other closely related Aspergillus species

    • Comparative sequence analysis indicates that while the core transport function is conserved, species-specific adaptations have occurred

  • Functional Diversification:

    • In saprophytic fungi like A. oryzae, tpc1 primarily functions in metabolic processes

    • In pathogenic fungi like M. oryzae, tpc1 has acquired additional regulatory functions

    • This diversification likely resulted from differential selection pressures in their respective ecological niches

  • Conservation Patterns:

    • Transmembrane domains show higher conservation, reflecting the essential transport function

    • Regulatory domains and protein interaction regions display greater variability

    • This pattern suggests that while the basic transport mechanism remains conserved, regulatory aspects have evolved to meet species-specific requirements

  • Evolutionary Timeline:

    • Genomic analysis indicates that the divergence between different Aspergillus species occurred relatively recently

    • Despite this recent divergence, functional specialization of proteins like tpc1 has occurred rapidly

These observations provide insights into how essential metabolic transporters can evolve to accommodate diverse ecological strategies while maintaining their fundamental biochemical functions.

How can recombinant A. oryzae tpc1 be used as a tool for studying mitochondrial transport mechanisms?

Recombinant A. oryzae tpc1 serves as an excellent model system for investigating fundamental aspects of mitochondrial transport:

  • Structure-Function Analysis:

    • Site-directed mutagenesis of specific residues can identify regions critical for substrate binding and transport

    • Creation of chimeric proteins by combining domains from different species' tpc1 can elucidate the structural basis for functional differences

    • Crystallization of the purified protein could provide detailed insights into the molecular mechanism of ThPP transport

  • Transport Mechanism Studies:

    • Reconstitution of purified tpc1 into artificial membrane systems allows detailed characterization of transport kinetics

    • Comparison of A. oryzae tpc1 with homologs from other species can reveal evolutionary adaptations in transport mechanisms

    • Investigation of how posttranslational modifications affect transport activity

  • Interaction Studies:

    • Identification of potential protein-protein interactions within the mitochondrial membrane

    • Analysis of how tpc1 might coordinate with other transporters to regulate mitochondrial metabolism

    • Investigation of potential regulatory factors that modulate tpc1 activity

  • Developmental Research Tools:

    • Generation of specific antibodies against recombinant tpc1 enables immunolocalization studies

    • Creation of fluorescently tagged tpc1 variants for live-cell imaging

    • Development of activity-based probes to monitor tpc1 function in real-time

These approaches collectively provide comprehensive insights into the fundamental mechanisms of mitochondrial metabolite transport, with broader implications for understanding eukaryotic cell biology.

What potential applications exist for engineering A. oryzae tpc1 in biotechnology?

Engineered variants of A. oryzae tpc1 present several promising biotechnological applications:

  • Enhanced Metabolic Engineering Platforms:

    • Optimization of tpc1 expression or activity could improve mitochondrial function in industrial strains

    • Enhanced ThPP transport may boost the efficiency of key metabolic enzymes, potentially increasing yields of desired products

    • Integration with other metabolic engineering strategies for comprehensive pathway optimization

  • Synthetic Biology Tools:

    • The thiamine-responsive regulatory elements associated with thiamine metabolism could be adapted for controlled gene expression systems

    • Development of genetic circuits using these elements could enable precise control over metabolic processes

    • Creation of biosensors based on tpc1 activity or ThPP levels for monitoring cellular metabolic status

  • Industrial Strain Improvement:

    • Enhancement of A. oryzae industrial strains through optimized tpc1 function

    • Potential to improve growth characteristics, stress tolerance, or product yields

    • Application in recombinant protein production systems, where efficient metabolism is crucial for high-level expression

  • Cross-Species Applications:

    • Transfer of engineered A. oryzae tpc1 variants to other industrial organisms

    • Improvement of mitochondrial function in heterologous hosts

    • Development of hybrid systems with enhanced metabolic capabilities

This research direction aligns with the increasing focus on using synthetic biology tools to enhance the industrial capabilities of A. oryzae, which has long been utilized in traditional food fermentation and is increasingly employed in modern biotechnology .

What techniques are most effective for studying tpc1 interactions with other proteins in the mitochondrial membrane?

Investigating tpc1 interactions within the complex environment of the mitochondrial membrane requires specialized approaches:

  • Proximity-Based Labeling Techniques:

    • BioID or APEX2 tagging of tpc1 to identify proximal proteins in the native mitochondrial environment

    • These methods enable identification of transient or weak interactions that might be lost in traditional pull-down approaches

    • Quantitative proteomics analysis of labeled proteins provides a comprehensive interactome

  • Membrane-Based Protein Complementation Assays:

    • Split-GFP or split-luciferase systems adapted for mitochondrial membrane proteins

    • Bimolecular Fluorescence Complementation (BiFC) in fungal cells

    • These techniques allow visualization of interactions in living cells

  • Cross-Linking Mass Spectrometry:

    • Chemical cross-linking of proteins in intact mitochondria followed by MS analysis

    • Photo-activatable cross-linkers can be incorporated into recombinant tpc1

    • This approach captures native interactions within the membrane environment

  • Computational Prediction and Validation:

    • Molecular docking simulations to predict potential interaction partners

    • Coevolution analysis across fungal species to identify conserved interaction interfaces

    • Experimental validation of predicted interactions using targeted approaches

  • Functional Interaction Studies:

    • Analysis of genetic interactions through synthetic lethality/sickness screens

    • Epistasis analysis with other mitochondrial transporters or metabolic enzymes

    • Assessment of how mutations in interacting partners affect tpc1 function

These methodologies collectively provide a multi-dimensional view of tpc1's interaction network within the mitochondrial membrane, helping to uncover its broader role in mitochondrial function and cellular metabolism.

How can researchers effectively differentiate between the multiple functions of tpc1 in experimental settings?

Differentiating between the transport function and potential regulatory roles of tpc1 presents a significant challenge that requires carefully designed experimental approaches:

  • Domain-Specific Mutagenesis:

    • Creation of transport-deficient mutants by targeting residues in transmembrane domains essential for ThPP binding/transport

    • Development of regulatory-function mutants by modifying potential protein interaction sites

    • Comparison of these mutants in functional assays can separate distinct activities

  • Selective Complementation Assays:

    • Express tpc1 variants in different mutant backgrounds (e.g., yeast tpc1Δ or M. oryzae tpc1Δ)

    • Assess rescue of specific phenotypes related to either transport or regulatory functions

    • Cross-species complementation to identify conserved versus specialized functions

  • Substrate Specificity Analysis:

    • Detailed characterization of transport kinetics using purified protein in liposomes

    • Competition assays with structural analogs of ThPP

    • Correlation of transport efficiency with phenotypic effects in vivo

  • Transcriptional Profiling:

    • RNA-seq analysis comparing wild-type and tpc1Δ strains under various conditions

    • Identification of genes whose expression changes may indicate regulatory functions

    • Time-course experiments to distinguish primary from secondary effects

  • Subcellular Localization Studies:

    • High-resolution imaging to determine precise localization within mitochondria

    • Investigation of potential dual localization (mitochondrial and nuclear)

    • Correlation of localization patterns with different functional states

  • Separation of Function Through Chimeric Proteins:

    • Creation of chimeric proteins combining domains from A. oryzae tpc1 (primarily transport) and M. oryzae tpc1 (transport plus regulation)

    • Functional testing of these chimeras to map specific activities to particular domains

    • This approach can directly link structural elements to distinct functions

These methodologies enable researchers to dissect the multifunctional nature of tpc1, providing a clearer understanding of how this protein contributes to various aspects of fungal cell biology.

What are the most promising unexplored aspects of A. oryzae tpc1 research?

Several high-potential research directions remain unexplored in the field of A. oryzae tpc1 biology:

  • Regulatory Mechanisms Controlling tpc1 Function:

    • Investigation of post-translational modifications affecting tpc1 transport activity

    • Study of how metabolic status influences tpc1 expression and localization

    • Identification of protein factors that might modulate tpc1 function in response to cellular needs

  • Integration with Broader Mitochondrial Networks:

    • Exploration of how tpc1 functions within the context of mitochondrial dynamics (fission/fusion)

    • Investigation of potential roles in mitochondria-associated membrane (MAM) functions

    • Analysis of how tpc1-mediated ThPP transport coordinates with other mitochondrial processes

  • Connections to Stress Response Pathways:

    • Examination of tpc1's role during oxidative stress conditions

    • Investigation of potential connections between tpc1 function and mitochondrial ROS production

    • Study of how tpc1 activity might change during various cellular stresses

  • Developmental Regulation:

    • Analysis of tpc1 expression and function during different developmental stages of A. oryzae

    • Investigation of potential roles in asexual development (conidiation)

    • Comparison with the developmental roles observed in pathogenic fungi like M. oryzae

  • System-Level Integration:

    • Application of multi-omics approaches to understand tpc1's place in the broader cellular network

    • Metabolic flux analysis to quantify the impact of tpc1 on central carbon metabolism

    • Modeling of how alterations in tpc1 function propagate through metabolic networks

These research directions would significantly advance our understanding of tpc1 biology and potentially reveal new applications in biotechnology and synthetic biology.

How might advances in structural biology and computational methods enhance our understanding of tpc1 function?

The integration of cutting-edge structural biology techniques and computational methods offers transformative potential for tpc1 research:

  • High-Resolution Structural Determination:

    • Cryo-electron microscopy (cryo-EM) could reveal tpc1's structure in different conformational states

    • X-ray crystallography of tpc1 alone or in complex with ThPP would provide atomic-level insights

    • NMR studies of specific domains could elucidate dynamic aspects of the transport mechanism

  • Molecular Dynamics Simulations:

    • All-atom simulations of tpc1 within a lipid bilayer environment

    • Investigation of the conformational changes during substrate binding and transport

    • Prediction of water and ion movements during the transport cycle

  • Machine Learning Applications:

    • Development of neural network models to predict the impact of mutations on tpc1 function

    • Identification of subtle sequence patterns that might correlate with functional specialization

    • Integration of multiple data types to generate predictive models of tpc1 activity

  • Systems Biology Approaches:

    • Genome-scale metabolic modeling to predict the systemic effects of altered tpc1 function

    • Network analysis to identify key interaction partners and functional modules

    • Constraint-based modeling to simulate the metabolic consequences of tpc1 variants

  • Synthetic Biology Design Tools:

    • Computational design of optimized tpc1 variants with enhanced transport properties

    • In silico modeling of genetic circuits incorporating tpc1-based components

    • Predictive design of tpc1 variants with novel substrate specificities

These advanced approaches would provide unprecedented insights into the molecular mechanisms underlying tpc1 function and evolution, driving both fundamental understanding and applied research in fungal biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.