Recombinant Aspergillus oryzae NADH-cytochrome b5 reductase 2 (mcr1)

Shipped with Ice Packs
In Stock

Description

Definition of Recombinant Aspergillus oryzae NADH-Cytochrome b5 Reductase 2 (mcr1)

Recombinant Aspergillus oryzae NADH-cytochrome b5 reductase 2 (mcr1) is an enzyme that has been produced through the introduction of a gene encoding NADH-cytochrome b5 reductase 2 (mcr1) into Aspergillus oryzae, a filamentous fungus, using recombinant DNA technology . The mcr1 gene in Aspergillus oryzae encodes for NADH-cytochrome b5 reductase 2, an enzyme involved in electron transport processes within the cell .

Background and Significance

NADH-cytochrome b5 reductase (CbR) is a crucial enzyme that facilitates electron transfer from NADH to cytochrome b5 . This electron transfer is essential for various metabolic pathways, including fatty acid desaturation, cholesterol biosynthesis, and drug metabolism . The Aspergillus oryzae variant is of particular interest due to the fungus's industrial importance, especially in enzyme production and food fermentation .

Molecular Cloning and Expression

The gene encoding NADH-cytochrome b5 reductase from Mortierella alpina was expressed in Aspergillus oryzae, resulting in a notable increase in ferricyanide reduction activity, which is indicative of CbR activity . The expression of the M. alpina CbR gene in A. oryzae led to a 4.7-fold increase in ferricyanide reduction activity in the microsomes, showcasing the successful incorporation of the recombinant enzyme into the endoplasmic reticulum .

Purification and Characterization

The recombinant M. alpina CbR was purified from Aspergillus oryzae through a series of chromatography steps, including DEAE-Sephacel, Mono-Q HR 5/5, and AMP-Sepharose 4B affinity column chromatography . This process resulted in a 645-fold increase in NADH-ferricyanide reductase specific activity . A significant loss of CbR activity was observed during the DEAE-Sephacel step due to aggregation of the enzyme with other membrane-bound proteins .

Role in Secondary Metabolism

Studies involving the deletion of mcrA, a multicluster regulator, in Aspergillus oryzae strain NSAR1 showed an increase in kojic acid production, suggesting a regulatory role of mcrA in secondary metabolism . Unlike in other ascomycetes, the deletion of mcrA in A. oryzae did not lead to the production of novel secondary metabolites, indicating that secondary metabolite production in this strain is regulated differently .

Applications and Significance

  • Enhancement of Kojic Acid Production: Deletion of mcrA can be employed to enhance kojic acid production in Aspergillus oryzae strains, which is valuable for industrial applications .

  • Cleaner Heterologous Production: Generation of kojic acid-deficient strains through CRISPR-Cas9 technology allows for a cleaner background for heterologous production of natural products .

  • Understanding Metabolic Pathways: Studying recombinant Aspergillus oryzae NADH-cytochrome b5 reductase 2 helps in understanding the metabolic capabilities and potential interplay between endogenous and exogenous pathways in Aspergillus oryzae .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested. Advance notice is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mcr1; AO090003000873; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-323
Protein Length
full length protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
mcr1
Target Protein Sequence
MFARQTFRCAQPLRQSFRKYSTEAPKAKSLAPIYTAVGLTGLSVGLYRYYYGAGATAEAP VERAKVFTGGDQGWVDLKLSEIEVLSHNTKRLRFEFEDKEAVSGVTIASALLTKFKPVGA EKAVLRPYTPTSDEDQPGYLDLVVKVYPNGPMSEHLHSMNVDQRLSFKGPLPKYQWETNK HEHIALIAGGTGITPMYQLIRQIFKNPDDKTKVTLVYGNVTEDDILLKKELQDLENTYPQ RFKAFYLLDKPPKEWTGGKGYINKELLKTVLPEPKEENQKIFVCGPPGLYNAVSGNKVSP KDQGELSGILKELGYNKDQVYKF
Uniprot No.

Target Background

Function
May mediate the reduction of outer membrane cytochrome b5.
Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

Advanced Research Questions

  • What purification strategies yield the highest recovery of active recombinant Aspergillus oryzae NADH-cytochrome b5 reductase 2?

The purification of recombinant NADH-cytochrome b5 reductase 2 presents significant challenges due to its membrane association and stability issues. An optimized purification protocol typically includes:

Step 1: Microsomal Preparation and Solubilization

  • Harvest cells and disrupt cell walls using mechanical methods (e.g., glass beads, French press)

  • Isolate microsomes via differential centrifugation

  • Solubilize membrane-bound enzyme using appropriate detergents

    • Critical note: While Triton X-100 effectively solubilizes the enzyme, it often causes protein aggregation and is difficult to remove. Cholic acid sodium salt is preferable as it can be easily removed by dialysis due to its low molecular mass aggregate

Step 2: Sequential Chromatography

Chromatography MethodPurposeCritical Parameters
DEAE-SephacelInitial capture and contaminant removalpH 7.5, 20 mM phosphate buffer with 20% glycerol
Mono-Q HR 5/5Intermediate purificationLinear NaCl gradient (0-0.5 M)
AMP-Sepharose 4BAffinity purificationEnzyme elution with NADH or NAD+

Step 3: Final Polishing and Storage

  • Concentrate the purified enzyme using ultrafiltration

  • Formulate in a stabilizing buffer containing glycerol (typically 20-50%)

  • Flash-freeze aliquots and store at -80°C

  • How do genetic variants of NADH-cytochrome b5 reductase 2 affect enzyme kinetics and substrate specificity?

Genetic variants of NADH-cytochrome b5 reductase 2 can significantly impact enzyme function, as demonstrated by studies on related cytochrome b5 reductases:

Structure-Function Relationships:
The enzymatic activity of NADH-cytochrome b5 reductase depends critically on conserved residues in the flavin-binding domain. Key findings include:

  • Conserved Triad: A specific arrangement of three highly conserved amino acid residues (arginine, tyrosine, and serine) plays a crucial role in binding with flavin through hydrogen bonds

  • Substrate Binding Domain: Mutations in this region can alter:

    • Coenzyme specificity (NADH vs. NADPH preference)

    • Binding affinity (Km)

    • Catalytic efficiency (kcat/Km)

  • Documented Variant Effects:

    • In human CYB5R3, novel variants R59H and R297H display atypical hydroxylamine reduction kinetics and decreased reduction efficiency

    • The S5A variant is associated with very low activity and protein expression

Kinetic Comparison Table:

ParameterWild-typeR59H VariantR297H Variant
Km for NADH5-15 μMIncreasedIncreased
Vmax0.08-0.12 μmol/min/mgDecreasedDecreased
Catalytic efficiency100%35-65%45-70%
NADH/NADPH selectivity>100:1MaintainedPartially compromised

These findings highlight how specific amino acid substitutions can alter not only the catalytic efficiency but also potentially shift substrate preferences. For recombinant A. oryzae NADH-cytochrome b5 reductase 2, site-directed mutagenesis studies targeting these key residues would provide valuable insights into structure-function relationships and potentially enable the engineering of variants with enhanced properties for biotechnological applications .

  • What strategies can overcome the challenges in heterologous expression and stability of recombinant NADH-cytochrome b5 reductase 2?

Heterologous expression of recombinant NADH-cytochrome b5 reductase 2 presents several challenges that can be addressed through strategic approaches:

Expression Challenges and Solutions:

  • Codon Optimization:

    • Problem: Inefficient translation due to codon bias differences between source and host organisms

    • Solution: Synthesize a codon-optimized gene sequence tailored to the host's preferred codon usage patterns

  • Fusion Protein Strategies:

    • Problem: Poor folding and stability of the recombinant protein

    • Solutions:

      • N-terminal fusion with solubility-enhancing tags (e.g., MBP, SUMO, thioredoxin)

      • Addition of a C-terminal His-tag for simplified purification

      • Design of cleavable linkers for tag removal post-purification

  • Expression Compartmentalization:

    • Problem: Cytotoxicity due to overexpression

    • Solution: Direct expression to specific cellular compartments (e.g., endoplasmic reticulum or peroxisomes) using appropriate signal sequences

Stability Enhancement Strategies:

  • Buffer Formulation Optimization:

    • Include glycerol (20-50%) as a stabilizing agent

    • Add low concentrations of reducing agents (e.g., DTT, β-mercaptoethanol)

    • Optimize pH and ionic strength

  • Protein Engineering:

    • Introduce disulfide bridges to enhance structural stability

    • Perform rational design to increase thermostability

    • Identify and mutate proteolytic cleavage sites

  • Co-expression Approaches:

    • Co-express with chaperones (e.g., GroEL/GroES, DnaK/DnaJ/GrpE)

    • Co-express with cytochrome b5 as its natural interaction partner

Evidence from studies with A. oryzae expressing NADH-cytochrome b5 reductase shows that the recombinant enzyme predominantly localizes to the microsomal fraction, with activity 11.3 times higher than in the cytosolic fraction, suggesting proper incorporation into the endoplasmic reticulum where it functions as an electron transporter . This correct localization is crucial for obtaining active enzyme.

  • How can CRISPR-Cas9 and other genetic tools be utilized to study or enhance NADH-cytochrome b5 reductase 2 expression in Aspergillus oryzae?

CRISPR-Cas9 technology and other genetic engineering approaches offer powerful tools for studying and enhancing NADH-cytochrome b5 reductase 2 in A. oryzae:

CRISPR-Cas9 Applications:

  • Precise Gene Editing:

    • Create knockout strains to study mcr1 function by introducing frameshifts or premature stop codons

    • Introduce specific mutations to study structure-function relationships

    • Perform promoter engineering to enhance expression levels

  • Multiplexed Engineering:

    • Simultaneously target multiple genes affecting NADH-cytochrome b5 reductase activity

    • Engineer metabolic pathways dependent on the enzyme's function

Research has demonstrated successful implementation of CRISPR-Cas9 in A. oryzae for precise genetic modifications. For example, the technology was used to disrupt kojic acid production by targeting the kojA gene, resulting in an 8 bp deletion at the target site and subsequent loss of function .

Alternative Genetic Engineering Approaches:

  • Promoter Replacement:

    • Replace the native mcr1 promoter with stronger constitutive promoters (e.g., PamyB, PgpdA)

    • Implement inducible promoters for controlled expression

  • Integration of Multiple Copies:

    • Use auxotrophic markers like niaD, sC, argB, and adeA for multiple integrations

    • Employ dominant selectable markers (e.g., hygromycin resistance) for additional integrations

  • Deletion of Negative Regulators:

    • Target genes that might negatively regulate mcr1 expression

    • Recent studies demonstrated that deletion of the secondary metabolism regulator mcrA increased kojic acid production, suggesting potential regulatory networks that could be manipulated

The combination of these approaches enables comprehensive study of mcr1 function and regulation, while also providing strategies to enhance enzyme production for research and biotechnological applications .

  • What is the relationship between NADH-cytochrome b5 reductase 2 (mcr1) and multicluster regulator A (mcrA) in controlling metabolic pathways in Aspergillus oryzae?

The relationship between NADH-cytochrome b5 reductase 2 (mcr1) and multicluster regulator A (mcrA) represents an intriguing area of research in A. oryzae metabolism:

Functional Distinctions:

Despite their similar nomenclature, mcr1 and mcrA represent distinct proteins with different functions:

  • mcr1 (NADH-cytochrome b5 reductase 2): An enzyme involved in electron transport systems and fatty acid metabolism

  • mcrA (multicluster regulator A): A transcriptional regulator that controls secondary metabolite production

Regulatory Interactions:

Studies investigating the deletion of mcrA in A. oryzae strain NSAR1 revealed:

  • Limited Impact on Secondary Metabolism:

    • Unlike in other ascomycetes where mcrA deletion substantially increases secondary metabolite production, in A. oryzae the only phenotypic change was doubled kojic acid production (from 1.23 to 2.52 g/L)

    • No novel secondary metabolites were produced

  • Potential Regulatory Network:

    • The findings suggest that secondary metabolite production in A. oryzae is repressed through mechanisms independent of McrA-mediated regulation

    • This indicates a unique evolutionary adaptation in A. oryzae compared to related species like A. flavus

Metabolic Implications:

The connection between mcr1 and secondary metabolism may involve:

  • Electron Transport Requirements:

    • Many secondary metabolite biosynthetic pathways require redox reactions

    • NADH-cytochrome b5 reductase may provide reducing equivalents for these processes

  • Fatty Acid-Derived Metabolites:

    • mcr1 is involved in fatty acid metabolism

    • Many secondary metabolites are derived from fatty acid precursors

This complex relationship suggests that while both proteins may influence secondary metabolism, they operate through distinct mechanisms that have been uniquely shaped during the domestication of A. oryzae from wild-type ancestors .

  • How do structural differences in NADH-cytochrome b5 reductase 2 across fungal species affect its enzymatic properties and potential applications?

Structural analysis of NADH-cytochrome b5 reductase 2 across fungal species reveals important evolutionary adaptations that influence its enzymatic properties:

Structural Conservation and Variation:

  • Core Domain Architecture:

    • NADH-cytochrome b5 reductases typically consist of two major domains:

      • A hydrophobic membrane-binding domain (N-terminal)

      • A catalytic flavin-binding domain (C-terminal)

    • The flavin-binding domain shows a conserved β-barrel structure across species

  • Critical Residues:

    • A specific arrangement of three highly conserved amino acid residues (arginine, tyrosine, and serine) forms hydrogen bonds with the flavin prosthetic group

    • These residues are conserved from fungi to mammals, indicating their essential role in enzyme function

  • Species-Specific Variations:

    • Surface residues show higher variability between species

    • Differences in the membrane-binding domain affect localization and interaction with other proteins

    • Glycosylation patterns vary significantly between fungal species

Comparative Enzymatic Properties:

PropertyA. oryzaeM. alpinaS. cerevisiaeMammals
Molecular weight~36 kDa33 kDa34 kDa34-36 kDa
pH optimum7.0-7.57.0-7.56.5-7.07.0-7.5
Thermal stabilityModerateModerateHighVariable
NADH/NADPH preferenceStrong NADHStrong NADHStrong NADHStrong NADH
Carbohydrate content12-15%VariableMinimalMinimal

Biotechnological Implications:

  • Enzyme Engineering Targets:

    • The conserved nature of the catalytic domain enables rational design approaches

    • Species-specific variations in thermal stability and substrate affinity can be exploited for directed evolution

  • Expression System Selection:

    • A. oryzae enzymes often show advantages for industrial applications due to their adaptations for secretion and stability

    • Understanding structural differences guides the choice of expression systems for recombinant production

  • Application-Specific Considerations:

    • For biocatalysis: Enzymes from thermophilic fungi offer greater process stability

    • For electron transport coupling: Species-specific interaction surfaces determine compatibility with other components

The detailed understanding of these structural differences provides essential insights for researchers seeking to harness NADH-cytochrome b5 reductase 2 for biotechnological applications, while also illuminating the evolutionary adaptations that have shaped enzyme function across fungal lineages .

  • What experimental approaches can determine the optimal conditions for maximizing catalytic activity of recombinant NADH-cytochrome b5 reductase 2?

Determining optimal conditions for recombinant NADH-cytochrome b5 reductase 2 requires systematic experimental approaches:

Biochemical Parameter Optimization

pH Optimization:

  • Construct a pH-activity profile using different buffer systems:

    • pH 5.0-6.0: Acetate or MES buffer

    • pH 6.0-7.5: Phosphate buffer

    • pH 7.5-9.0: Tris-HCl or HEPES buffer

  • Measure enzyme activity at each pH under standard conditions

  • Based on similar enzymes, optimal activity likely occurs in the pH 7.0-7.5 range

Temperature Optimization:

  • Measure enzyme activity across a temperature range (typically 25-65°C)

  • Determine both the temperature optimum for activity and thermal stability profile

  • Examine thermal denaturation kinetics by measuring activity after pre-incubation at different temperatures

Cofactor and Substrate Analysis

Cofactor Preference:

  • Compare activity with NADH versus NADPH as electron donors

  • Determine Km and Vmax for each cofactor

  • Examine the effect of NAD+/NADH ratio on enzyme kinetics

  • Previous studies indicate strong preference for NADH over NADPH

Electron Acceptor Optimization:

  • Test various electron acceptors:

    • Ferricyanide [K₃Fe(CN)₆]

    • DCPIP (2,6-dichlorophenolindophenol)

    • Cytochrome b5

    • Artificial electron acceptors

  • Determine kinetic parameters for each acceptor

Experimental Design for Optimization

Response Surface Methodology:

  • Design a central composite or Box-Behnken experimental plan

  • Simultaneously evaluate multiple parameters (pH, temperature, ionic strength)

  • Generate response surfaces to identify optimal combinations

Example Experimental Matrix:

ExperimentpHTemperature (°C)[NADH] (μM)[Salt] (mM)Activity (U/mg)
16.53010050To be measured
27.53010050To be measured
..................
n7.040200150To be measured

Stabilizing Conditions Assessment

  • Test various additives:

    • Glycerol (10-50%)

    • Reducing agents (DTT, β-mercaptoethanol)

    • Divalent cations (Mg²⁺, Ca²⁺)

    • Protein stabilizers (BSA, PEG)

  • Examine long-term storage stability:

    • Measure activity retention at different temperatures (-80°C, -20°C, 4°C)

    • Evaluate freeze-thaw stability over multiple cycles

    • Test lyophilization with different cryoprotectants

By systematically implementing these experimental approaches, researchers can establish optimal conditions that maximize both the activity and stability of recombinant NADH-cytochrome b5 reductase 2, enhancing its utility for both research and biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.