Recombinant Aspergillus oryzae Patatin-like phospholipase domain-containing protein AO090003000839 (AO090003000839)

What is the structural composition of AO090003000839?

AO090003000839 is a patatin-like phospholipase domain-containing protein from Aspergillus oryzae with a full-length sequence of 717 amino acids. Like other patatin-like phospholipases (PLPs), it contains a catalytic serine lipase motif G-X-S-X-G, a serine-aspartate dyad, and a glycine-rich oxyanion hole that are essential for its enzymatic activity . The protein's amino acid sequence begins with MNSPEKSAACDIYDPKSIPDYDREFIDPDDLRQFENALNDNESNSLVALNDWRPIYQRVR and continues through a complex sequence that defines its structural and functional properties .

What is the predicted enzymatic function of AO090003000839?

Based on its classification as a patatin-like phospholipase, AO090003000839 likely exhibits phospholipase A2 activity (EC 3.1.1.-). This enzymatic activity involves hydrolyzing the sn-2 acyl bond of phospholipids to release free fatty acids and lysophospholipids . Unlike some mammalian patatin-like proteins that may lack significant phospholipase activity, fungal patatin-like proteins often retain this function, potentially playing roles in lipid metabolism and possibly in host-pathogen interactions .

How does AO090003000839 compare to other patatin-like proteins across species?

Patatin-like phospholipases are found across various organisms including animals, plants, and microbes. While humans have 9 PLPs (annotated as PNPLAs), plants like Arabidopsis have 10 PLPs, some of which are pathogen-induced and play roles in defense responses . The AO090003000839 protein shares the core catalytic features of this family but likely has specific adaptations related to its role in fungal physiology. Comparative sequence analysis reveals conservation of the catalytic domains while showing variation in regulatory regions that may influence substrate specificity and biological function .

What expression systems are optimal for recombinant production of AO090003000839?

For research applications, E. coli has been successfully used as an expression host for AO090003000839 . When expressing this fungal protein in bacterial systems, consider the following methodological approach:

• Gene optimization for E. coli codon usage

• Use of appropriate fusion tags (His-tag is commonly employed)

• Optimization of induction conditions (temperature, IPTG concentration, duration)

• Implementation of proper folding conditions to maintain enzymatic activity

For optimal activity, expression in eukaryotic systems like yeast (Pichia pastoris) or insect cells may provide better post-translational modifications, although at higher production complexity and cost .

What purification protocols yield high-purity AO090003000839 for enzymatic studies?

A multi-step purification approach is recommended for isolating high-purity AO090003000839:

• Initial capture via affinity chromatography (IMAC for His-tagged protein)

• Intermediate purification using ion exchange chromatography

• Polishing step with size exclusion chromatography

• Buffer optimization to maintain stability (typically Tris-based buffer with glycerol)

Purification results should be validated through SDS-PAGE analysis, with purity exceeding 90% for reliable enzymatic studies . Store purified protein in buffer containing 50% glycerol at -20°C or -80°C to maintain long-term stability, avoiding repeated freeze-thaw cycles .

How can researchers effectively measure the phospholipase activity of AO090003000839?

To characterize the phospholipase A2 activity of AO090003000839, implement the following assay approaches:

When designing activity assays, control for buffer composition, pH, temperature, and divalent cation concentrations as these can significantly impact enzymatic activity .

How should researchers design experiments to study the biological role of AO090003000839 in Aspergillus oryzae?

When investigating the biological function of AO090003000839, implement a multi-faceted experimental design:

• Gene knockout/knockdown studies: Generate AO090003000839-deficient strains using CRISPR-Cas9 or RNAi approaches to observe phenotypic changes.

• Overexpression studies: Create strains with enhanced AO090003000839 expression to identify gain-of-function effects.

• Localization experiments: Utilize fluorescent protein fusions to determine subcellular localization.

• Metabolomic profiling: Compare lipid profiles between wild-type and modified strains to identify metabolic pathways affected.

Follow these experimental design steps:

• Define your variables (independent: AO090003000839 expression levels; dependent: growth rates, stress responses, lipid profiles)

• Formulate specific hypotheses about protein function

• Design experimental treatments with appropriate controls

• Randomly assign samples to eliminate bias

• Measure outcomes using standardized protocols

What controls are essential when studying the enzymatic activity of AO090003000839?

Implementing proper controls is critical for reliable characterization of AO090003000839:

These methodological controls help distinguish true enzymatic activity from artifacts and provide confidence in experimental outcomes .

How should researchers analyze kinetic data from AO090003000839 enzymatic assays?

For rigorous kinetic analysis of AO090003000839:

• Initial rate determination: Measure activity at early time points (linear range) across multiple substrate concentrations.

• Michaelis-Menten analysis: Calculate Km and Vmax parameters using non-linear regression:

  $v = \frac{V_{max} \times [S]}{K_m + [S]}$

• Lineweaver-Burk transformation: Plot 1/v versus 1/[S] to visualize kinetic parameters and identify inhibition patterns.

• Inhibition studies: Determine Ki values and inhibition mechanisms (competitive, non-competitive, uncompetitive).

Present data in clear, informative tables:

*Values to be determined experimentally

Analyze statistical significance using appropriate tests (ANOVA, t-test) and report p-values with confidence intervals .

How can researchers address experimental variability when working with AO090003000839?

To manage experimental variability:

• Standardize protein preparation: Use consistent expression and purification protocols across experiments.

• Validate protein quality: Assess batch-to-batch variation through activity assays and SDS-PAGE.

• Implement statistical controls: Use randomization in experimental design and blind analysis when possible.

• Apply normalization techniques: When comparing across experiments, normalize to internal standards or reference activities.

• Report comprehensive error metrics: Include standard deviation, standard error, and confidence intervals in data presentation .

Document all experimental conditions meticulously in laboratory notebooks and publications to facilitate reproducibility across research groups.

How can AO090003000839 be applied in comparative studies with patatin-like phospholipases from pathogenic organisms?

Patatin-like phospholipases appear in various pathogens, including protozoan parasites in the Apicomplexa phylum (causative agents of malaria, toxoplasmosis, and cryptosporidiosis) . For comparative studies:

• Phylogenetic analysis: Construct evolutionary trees to understand relationships between fungal and protozoan PLPs.

• Structural comparisons: Generate homology models or crystal structures to identify conserved and divergent regions.

• Functional complementation: Express AO090003000839 in PLP-deficient pathogens to assess functional conservation.

• Inhibitor screening: Test whether inhibitors effective against AO090003000839 also target pathogen PLPs, potentially identifying broad-spectrum antimicrobial targets.

This comparative approach may reveal evolutionary adaptations of phospholipases across microbial species and identify potential therapeutic targets .

What are the considerations for designing AO090003000839 mutants to probe structure-function relationships?

When engineering AO090003000839 variants:

• Catalytic site mutations: Target the serine-aspartate dyad and glycine-rich oxyanion hole to confirm catalytic mechanism.

• Domain swapping: Exchange domains with related PLPs to determine substrate specificity determinants.

• Surface residue modifications: Alter surface properties to investigate protein-protein or protein-membrane interactions.

• Conservative vs. non-conservative substitutions: Implement both to distinguish between structural and functional roles of specific residues.

Design a systematic mutagenesis approach:

Express mutants in parallel with wild-type protein as controls and characterize using consistent methodological approaches to enable direct comparisons .

Concluding Recommendations for Researchers

When working with Recombinant Aspergillus oryzae Patatin-like phospholipase domain-containing protein AO090003000839, researchers should:

• Validate protein identity and purity through multiple analytical methods

• Implement comprehensive controls in all experimental designs

• Consider evolutionary and comparative aspects when interpreting functional data

• Apply rigorous statistical analysis to all quantitative measurements

• Document methods thoroughly to ensure reproducibility