Recombinant Aspergillus oryzae Probable endonuclease lcl3 (lcl3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Aspergillus oryzae Probable Endonuclease lcl3 (lcl3)

Recombinant Aspergillus oryzae Probable Endonuclease lcl3 (lcl3) is a recombinant protein derived from the gene lcl3 in Aspergillus oryzae strain ATCC 42149/RIB 40 (Yellow koji mold). The protein is classified as a probable endonuclease, though its specific biochemical activity and substrate specificity remain incompletely characterized .

Biochemical and Functional Insights

The recombinant lcl3 protein is produced as a research-grade reagent, primarily for use in immunoassays (e.g., ELISA) . Limited experimental data exist to confirm its enzymatic activity or substrate preferences.

Comparative Context

While A. oryzae produces well-characterized nucleases like RNase T2 (a base-non-specific RNase with 3’→5’ exonuclease activity) , lcl3 remains poorly studied. Unlike RNase T2, which is glycosylated (12–15% carbohydrate content) , lcl3’s post-translational modifications are unreported.

Potential Applications

  1. Enzymatic Studies:

    • Investigating endonuclease activity in A. oryzae genome editing or RNA/DNA processing.

    • Screening for substrate specificity (e.g., DNA vs. RNA preference).

  2. Biotechnological Development:

    • Engineering lcl3 variants for precision cleavage in bioprocessing.

Challenges

  • Limited Functional Data: No peer-reviewed studies validate its enzymatic activity or biological role .

  • Production Constraints: Recombinant expression systems (e.g., Komagataella phaffii for RNase T2) may require optimization for lcl3 yield and purity.

Product-Specific Data (Data Table 2)

ParameterDetail
PurityNot quantified (research-grade)
Tag InformationTag type determined during production (e.g., His-tag, GST-tag)
StabilityStable at -20°C; repeated freeze-thaw cycles discouraged

Recommended Protocols

  • Handling: Avoid exposure to divalent cations (e.g., Cu²⁺, Zn²⁺), which may inhibit activity .

  • Storage: Aliquot and store at -20°C to prevent degradation.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
lcl3; AO090005000757; Probable endonuclease lcl3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-277
Protein Length
full length protein
Species
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Target Names
lcl3
Target Protein Sequence
MRWPPWASESQARDKQDEQNQKNWDKSLNAIDWAAFTEPRTLIPTLILTTGIIGALQIHR RYLRRFPDAVSISPSYFRKRTILGQVTSVGDGDGFRLYHTPGGRLAGWGWLPWKRVPTAK KDLRDKTISVRLAGVDAPELAHFGRPEQPYAREAHEWLTSYVLNRRVRVLVHRQDQYQRV VASAYVRRAIDFPIPFRRRDVSYEMLTRGLATVYEAKAGSEFGGPELERKYREAESIAKR KGTGLWKGYRRNRKGWESPREYKTRMGLEEQSQGKGN
Uniprot No.

Target Background

Database Links
Protein Families
LCL3 family
Subcellular Location
Mitochondrion. Membrane; Single-pass membrane protein.

Q&A

What is Aspergillus oryzae and why is it significant for recombinant protein production?

Aspergillus oryzae is a filamentous fungus historically used in East Asian food fermentation for products including sake, shōchū, soy sauce, and miso. It has gained scientific importance as a host for heterologous protein expression due to its GRAS (Generally Recognized As Safe) status and efficient protein secretion capabilities. A. oryzae evolved from Aspergillus flavus but contains non-functional aflatoxin synthesis gene clusters, making it safe for biotechnological applications. In Japan, it's even been designated as a "national fungus" (kokkin) due to its cultural significance and widespread use in traditional fermentation processes.

For recombinant protein production, A. oryzae offers several advantages over bacterial expression systems, including proper eukaryotic post-translational modifications and a naturally robust secretion pathway that facilitates downstream purification processes.

What are the optimal expression systems for producing recombinant lcl3 in laboratory settings?

For successful expression of recombinant lcl3 in laboratory settings, researchers should consider both homologous (within A. oryzae) and heterologous expression systems. Based on current research methodologies with A. oryzae proteins, the following approaches have demonstrated effectiveness:

Homologous Expression in A. oryzae:
The most direct approach utilizes A. oryzae itself as the expression host, employing strong inducible promoters such as the amyB promoter (derived from the α-amylase gene). This promoter is particularly effective as it can be induced by maltose, providing controlled expression. For optimal results, the expression construct should include the amyB promoter driving the lcl3 gene, followed by the amyB terminator.

Heterologous Expression Systems:
Alternative systems include:

  • Pichia pastoris: Useful for high-density fermentation and controlled induction

  • Escherichia coli: Faster but may require refolding due to inclusion body formation

  • Insect cell systems: Better for complex eukaryotic proteins requiring specific modifications

Expression SystemAdvantagesDisadvantagesOptimal MediaInduction Method
A. oryzaeNative environment, proper folding, natural secretionSlower growth, complex genetic manipulationYPM medium (yeast extract, peptone, maltose)Maltose induction of amyB promoter
P. pastorisHigh yield, controlled methanol inductionRequires optimization of methanol feedingBMMY mediaMethanol addition
E. coliRapid growth, high yieldPotential inclusion bodies, lack of post-translational modificationsLB or TB mediaIPTG for T7 promoter

How can researchers design optimal gene constructs for expressing recombinant lcl3?

When designing gene constructs for recombinant lcl3 expression in A. oryzae, researchers should implement the following strategies:

  • Promoter Selection: The amyB promoter from A. oryzae is highly effective for inducible expression. This promoter is activated by maltose, allowing controlled protein production. Alternative strong promoters include the glaA (glucoamylase) and TEF1 (translation elongation factor) promoters.

  • Codon Optimization: While not always necessary when expressing within A. oryzae, codon optimization becomes critical for heterologous expression. Analyze the codon usage bias of A. oryzae and optimize the lcl3 sequence accordingly when expressing in other hosts.

  • Signal Peptide Integration: For efficient secretion, incorporate a signal peptide such as the native A. oryzae α-amylase signal sequence or the A. niger glucoamylase signal sequence.

  • Terminator Selection: The amyB terminator has proven effective in A. oryzae expression systems, contributing to mRNA stability and proper transcription termination.

  • Selection Markers: Common selection markers for A. oryzae include pyrG (orotidine-5'-phosphate decarboxylase), sC (sulfate adenyltransferase), niaD (nitrate reductase), and argB (ornithine carbamoyltransferase). The choice depends on the genetic background of your host strain.

  • Vector Backbone: For integration into the A. oryzae genome, design your construct with homologous sequences flanking the expression cassette, targeting known neutral sites that don't disrupt essential functions.

How can researchers confirm successful expression and biological activity of recombinant lcl3?

Verifying successful expression and functional activity of recombinant lcl3 requires a multi-tiered approach:

Expression Verification:

  • Quantitative RT-PCR (qRT-PCR): Design primers specific to the lcl3 gene (consider regions near the 5'-end, middle, and 3'-end for comprehensive coverage). Extract mRNA from transformed strains, synthesize cDNA, and perform qRT-PCR. Compare transcript levels with housekeeping genes such as histone H4 for normalization.

  • Western Blot Analysis: Generate antibodies against lcl3 or add an epitope tag (His-tag, FLAG, etc.) to the recombinant protein. Perform SDS-PAGE followed by Western blotting to detect the protein in cell extracts or culture supernatants.

  • Mass Spectrometry: Perform LC-MS analysis to confirm the identity of the purified protein. Compare the peptide mass fingerprint with the theoretical profile derived from the lcl3 sequence.

Activity Assays:
For endonuclease activity verification, develop assays using different nucleic acid substrates:

  • Gel-based Nuclease Assays: Incubate purified lcl3 with plasmid DNA, single-stranded DNA, or RNA substrates at different pH values and metal ion concentrations. Visualize digestion products on agarose or polyacrylamide gels.

  • Fluorescence-based Assays: Use fluorescently labeled nucleic acid substrates with quenchers. Endonuclease activity will separate the fluorophore from the quencher, resulting in increased fluorescence that can be measured using a microplate reader.

What advanced techniques are available for structural and functional characterization of lcl3?

Structural Characterization:

Functional Characterization:

  • Site-directed Mutagenesis: Generate lcl3 variants with mutations in conserved residues to identify catalytically important amino acids.

  • Substrate Specificity Profiling: Test activity against a library of different DNA/RNA substrates to determine sequence or structural preferences.

  • Kinetic Analysis: Determine enzymatic parameters (Km, kcat, Vmax) using varying substrate concentrations and reaction conditions.

  • Interaction Studies: Use techniques such as isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or bio-layer interferometry (BLI) to study protein-protein or protein-nucleic acid interactions.

What are common challenges in expressing recombinant endonucleases in A. oryzae and how can they be addressed?

Recombinant endonuclease expression in A. oryzae can encounter several challenges. Below are common issues and evidence-based solutions:

Challenge 1: Low expression levels

  • Solution: Optimize the promoter system. While the amyB promoter is commonly used, expression can be enhanced by adjusting induction conditions. Culture transformants in YPM medium containing maltose as an inductive substrate for the amyB promoter. Quantify transcript levels by qRT-PCR and compare with housekeeping genes like histone H4 to ensure adequate expression.

Challenge 2: Promoter incompatibility

  • Solution: Research has shown that native promoters from source organisms may not function optimally in A. oryzae. For example, studies demonstrated that the C. clavata promoter did not work appropriately in A. oryzae. Replace native promoters with well-characterized A. oryzae promoters such as amyB, glaA, or TEF1.

Challenge 3: Protein misfolding or degradation

  • Solution: Co-express molecular chaperones or modify culture conditions. Lower the culture temperature to 20-25°C instead of the standard 30°C to slow protein synthesis and aid proper folding. If intracellular degradation is suspected, consider adding protease inhibitors or using protease-deficient A. oryzae strains.

Challenge 4: Toxicity of expressed endonuclease

  • Solution: Implement tightly controlled inducible expression systems. For endonucleases like lcl3 that may be toxic to the host, use extremely tight regulation via the Tet-Off or Tet-On systems adapted for fungal expression. Alternatively, express the protein as an inactive fusion that requires post-purification activation.

What optimization strategies can improve recombinant lcl3 yield and purity?

Strain Engineering Approaches:

  • Protease-deficient Strains: Use or develop A. oryzae strains with mutations in major secreted proteases to reduce degradation of the target protein.

  • Chaperone Co-expression: Engineer strains to co-express molecular chaperones such as BiP, PDI, or calnexin to assist in proper protein folding.

  • Genome Editing: Utilize CRISPR/Cas9 systems adapted for A. oryzae to knock out competing secretory pathways or enhance specific aspects of protein processing.

Culture Optimization:

  • Media Composition: Conduct a systematic analysis of media components using design of experiments (DOE) methodology. Optimal media for A. oryzae typically contains:

    • Carbon source: 2-5% maltose for amyB promoter induction

    • Nitrogen source: 1-2% peptone or yeast extract

    • Trace elements: Mg, Ca, Fe, Zn, Cu, Mn

    • pH buffer: Maintain pH 5.0-6.0 for optimal growth and expression

  • Fermentation Parameters:

    • Temperature: 25-28°C typically provides better balance between growth and protein stability

    • Aeration: Maintain dissolved oxygen above 30% saturation

    • pH control: Automatic adjustment to pH 5.5-6.0

    • Feeding strategy: Fed-batch culture with controlled carbon source addition

Purification Strategies:
Optimize a multi-step purification protocol:

  • Initial clarification by centrifugation (6,000-10,000×g, 20 min, 4°C)

  • Ammonium sulfate precipitation (40-60% saturation)

  • Ion exchange chromatography (typically DEAE or SP depending on lcl3's pI)

  • Size exclusion chromatography for final polishing

  • Consider affinity chromatography if a tag has been added to the recombinant lcl3

How can researchers utilize recombinant lcl3 in genome editing and molecular biology applications?

Potential Applications in DNA Manipulation:
If characterized as a site-specific endonuclease, recombinant lcl3 could be developed for various DNA manipulation technologies:

  • Genome Editing: If lcl3 demonstrates sequence specificity, it could potentially be engineered as a novel genome editing tool, complementing existing CRISPR/Cas and TALEN systems. Research would need to characterize:

    • Recognition sequence specificity

    • Cleavage pattern (blunt vs. staggered ends)

    • Targeting efficiency and off-target effects

  • Molecular Cloning Applications: Depending on its sequence specificity, lcl3 could serve as a novel restriction enzyme for molecular cloning workflows. Researchers should determine:

    • Recognition site(s)

    • Optimal reaction conditions (buffer, temperature, cofactors)

    • Compatibility with existing cloning systems

  • Nucleic Acid Quality Control: If lcl3 demonstrates DNase/RNase activity with specific characteristics, it could be utilized for:

    • Removal of contaminating genomic DNA from RNA preparations

    • Specialized DNA fragmentation for next-generation sequencing libraries

    • Development of novel DNA/RNA detection assays

What are the emerging research directions for understanding endonuclease diversity in Aspergillus species?

Comparative Genomics Approaches:

Research into A. oryzae endonucleases like lcl3 opens opportunities for broader understanding of fungal nuclease diversity. Key research directions include:

  • Phylogenetic Analysis: Compare lcl3 with homologous endonucleases across the Aspergillus genus and related fungi to understand evolutionary relationships and functional divergence. This approach can reveal:

    • Conservation of catalytic domains

    • Species-specific adaptations

    • Potential horizontal gene transfer events

  • Structure-Function Relationships: Use comparative structural modeling across homologous enzymes to predict:

    • Substrate binding sites

    • Catalytic mechanisms

    • Potential for engineering novel specificities

  • Biological Role Investigation: Employ gene knockout or knockdown studies in A. oryzae to determine the physiological role of lcl3, which remains largely unknown. Potential functions might include:

    • DNA repair mechanisms

    • Recombination processes

    • Defense against foreign DNA

    • RNA processing and turnover

Table: Comparison of Endonuclease Systems Across Aspergillus Species

SpeciesNotable EndonucleasesCharacterized FunctionsBiotechnological Applications
A. oryzaelcl3, others to be characterizedProbable nucleic acid processing (specific functions under investigation)Potential tool for molecular biology, protein engineering target
A. nidulansEndA, NucA, NucBDNA repair, recombinationGenetic research models
A. flavusSeveral restriction-modification systemsDefense against foreign DNAUnderstanding pathogenicity mechanisms
A. fumigatusMultiple DNases and RNasesVirulence factors, nutrient acquisitionTargets for antifungal development

What are the optimal storage and handling conditions for maintaining lcl3 stability and activity?

Based on product information and general principles for endonuclease handling, researchers should follow these evidence-based guidelines:

Storage Conditions:

  • Store at -20°C for general storage, or at -80°C for extended preservation

  • Avoid repeated freeze-thaw cycles which can significantly reduce enzyme activity

  • For working solutions, aliquot and store at 4°C for up to one week

  • Use storage buffer containing Tris-based buffer with 50% glycerol optimized for protein stability

Handling Guidelines:

  • Temperature Management: Keep the enzyme on ice during experimental setup. Return to appropriate storage promptly after use.

  • Buffer Optimization: For reaction buffers, typically include:

    • 20-50 mM Tris-HCl (pH 7.5-8.5) or other suitable buffer

    • 5-10 mM MgCl₂ (or other divalent cations as determined through activity testing)

    • 1-5 mM DTT to maintain reduced state of cysteine residues

    • 50-100 mM NaCl or KCl (adjust based on activity optimization)

  • Stabilizing Additives: Consider adding 0.1-0.5% BSA or 0.01-0.1% Triton X-100 to prevent surface adsorption and maintain activity in dilute solutions.

  • Quality Control: Periodically verify enzyme activity using standardized assays before crucial experiments.

How can researchers design controlled experiments to accurately characterize lcl3 enzymatic properties?

Experimental Design Principles:

  • Substrate Preparation:

    • Prepare diverse nucleic acid substrates: supercoiled plasmid DNA, linearized DNA, single-stranded DNA, RNA

    • For specificity testing, create substrates with different sequence compositions

    • Include appropriate controls for each substrate type

  • Reaction Parameter Optimization:

    • pH Profiling: Test activity across pH range 5.0-9.0 in 0.5 pH unit increments

    • Temperature Profiling: Evaluate activity at 4°C, 25°C, 30°C, 37°C, 42°C, and 55°C

    • Metal Ion Dependency: Test activity with various divalent cations (Mg²⁺, Mn²⁺, Ca²⁺, Zn²⁺, Ni²⁺) at 1-10 mM concentrations

    • Salt Sensitivity: Evaluate activity at different ionic strengths (0-500 mM NaCl)

  • Kinetic Analysis:

    • Establish initial velocity conditions where substrate conversion is linear with time

    • Perform substrate concentration series to determine Km and Vmax

    • Analyze data using appropriate enzyme kinetics software (e.g., GraphPad Prism, EnzymeKinetics)

  • Inhibition Studies:

    • Test sensitivity to common nuclease inhibitors (EDTA, EGTA, SDS, urea)

    • Determine IC₅₀ values for relevant inhibitors

    • Investigate the mechanism of inhibition (competitive, non-competitive, uncompetitive)

  • Quality Controls:

    • Include no-enzyme controls to detect contaminating nuclease activity

    • Use commercial endonucleases with known properties as reference standards

    • Prepare multiple enzyme dilutions to ensure response linearity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.