Recombinant Aspergillus terreus Golgi apparatus membrane protein tvp23 (tvp23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please communicate it to us. We will prioritize developing the specified tag.
Synonyms
tvp23; ATEG_03187; Golgi apparatus membrane protein tvp23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Target Names
tvp23
Target Protein Sequence
MEQEPLQPRQGDLNWRLSAHPVTLLCFLGIRLSALLMYLFGILFIKHFILVFIITLLLLA ADFYYLKNIAGRRLVGLRWWNEVNTTTGDSHWVFESSDPNTRTITATDKRFFWLSLYVTP AFWIGLAILAVIQLSVIWLSLVVIALVLTITNTVAFSRCDRFSQASTFANRALSGGIVSN IAGGLLGRLFK
Uniprot No.

Target Background

Function
Golgi membrane protein involved in vesicular trafficking.
Database Links
Protein Families
TVP23 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Aspergillus terreus Golgi apparatus membrane protein tvp23?

Recombinant Aspergillus terreus Golgi apparatus membrane protein tvp23 is a 191-amino acid transmembrane protein that functions within the Golgi network of Aspergillus terreus. The protein is typically expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification . Based on homology with similar proteins in other organisms, particularly the TVP23 family in humans, tvp23 is hypothesized to be involved in vesicular transport, specifically in retrograde transport from early endosomes to the late Golgi apparatus . The protein contains multiple transmembrane domains with a secondary structure primarily composed of alpha helices forming transmembrane segments.

How is recombinant tvp23 typically expressed and purified for research?

For research applications, the methodological approach to expressing and purifying recombinant tvp23 typically involves:

  • Cloning the tvp23 gene into a suitable expression vector (commonly pET-based) with an N-terminal His-tag

  • Transforming the construct into E. coli expression strains (such as BL21(DE3))

  • Inducing expression under optimized conditions

  • Harvesting cells and lysing them under conditions that preserve protein integrity

  • Purifying the protein using immobilized metal affinity chromatography (IMAC) via the His-tag

  • Further purification steps if needed (size exclusion, ion exchange chromatography)

  • Buffer exchange to a storage buffer (typically Tris/PBS-based with 6% trehalose, pH 8.0)

  • Lyophilization for long-term storage

The purified protein is typically reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage at -20°C/-80°C to prevent freeze-thaw damage .

What are the optimal conditions for expressing recombinant tvp23 in heterologous systems?

Optimizing expression of recombinant tvp23 requires systematic testing of various parameters. The following table presents recommended conditions based on general practices for membrane proteins:

ParameterRecommended ConditionsRationale
Expression hostE. coli BL21(DE3), C41(DE3), or C43(DE3)Strains optimized for membrane protein expression
VectorpET with N-terminal His-tagProvides efficient expression and purification capability
Induction temperature16-20°CLower temperatures reduce inclusion body formation
Inducer concentration0.1-0.5 mM IPTGModerate induction prevents protein misfolding
Induction duration16-20 hoursExtended time at lower temperature improves folding
Media supplements0.5-1% glucose, 1 mM betaineControls basal expression; betaine acts as osmolyte

For methodological validation, researchers should conduct small-scale expression trials varying these parameters, followed by SDS-PAGE and Western blot analysis to assess protein quantity and quality. Optimization should focus on maximizing the yield of properly folded, functional protein while minimizing aggregation or misfolding .

What genetic modification approaches are most effective for studying tvp23 function in Aspergillus terreus?

Several genetic modification approaches have been successfully applied to Aspergillus species and can be employed for studying tvp23 function:

  • CRISPR-Cas9 system:

    • Provides high gene-targeting efficiency (>90%) in A. terreus

    • Utilizes the AMA1 (autonomously replicating sequence) for effective transformation

    • Enables precise gene knockout, knockin, or point mutations

  • Homologous Recombination (HR) approaches:

    • Traditional method requiring longer homology arms

    • Efficiency can be improved by suppressing non-homologous end joining pathways

    • Allows for precise gene replacements or modifications

  • Transformation methods for delivering genetic constructs:

    • Polyethylene glycol (PEG) Mediated Transformation of protoplasts

    • Agrobacterium tumefaciens Mediated Transformation

    • Electroporation or Biolistic Transformation as alternatives

The methodological workflow typically involves designing targeting constructs, transformation using one of the above methods, selection of transformants, verification of genetic modifications by PCR and sequencing, and subsequent phenotypic analysis to assess the impact on tvp23 function .

How can the subcellular localization of tvp23 be experimentally visualized in Aspergillus terreus?

Visualizing the subcellular localization of tvp23 requires specialized approaches for filamentous fungi. A comprehensive methodological approach includes:

  • Genetic tagging strategy:

    • Create a fusion construct of tvp23 with a fluorescent protein (GFP or mCherry)

    • Ensure the tag position (N- or C-terminal) doesn't disrupt function

    • Use CRISPR-Cas9 for precise integration at the native locus

  • Transformation into A. terreus:

    • Utilize optimized transformation protocols (commonly PEG-mediated)

    • Select transformants using appropriate markers

    • Verify correct integration by PCR and expression by Western blotting

  • Microscopy and co-localization:

    • Apply confocal microscopy to visualize the fluorescent fusion protein

    • Perform co-staining with established Golgi markers

    • Conduct z-stack imaging to capture three-dimensional distribution

  • Functional validation:

    • Ensure the tagged protein retains wild-type function

    • Consider immunoelectron microscopy for ultra-structural localization

This approach enables both static imaging of tvp23 distribution and potentially dynamic studies of its trafficking behavior within the Golgi network .

How do mutations in the transmembrane domains of tvp23 affect its localization and function?

While specific research on tvp23 mutations in A. terreus is limited, studies on homologous proteins suggest that the transmembrane domains are critical for proper localization and function. To investigate this experimentally:

  • Generate a series of site-directed mutants:

    • Target conserved residues within predicted transmembrane domains

    • Create both conservative and non-conservative substitutions

    • Develop truncation mutants to assess domain requirements

  • Express mutant proteins with fluorescent tags:

    • Transform into A. terreus using optimized protocols

    • Include wild-type tagged control for comparison

  • Assess localization patterns:

    • Use confocal microscopy to determine subcellular distribution

    • Quantify co-localization with Golgi markers

    • Analyze potential mislocalization patterns

  • Evaluate functional consequences:

    • Measure vesicular transport efficiency using established assays

    • Assess Golgi morphology and integrity

    • Determine impact on protein secretion pathways

  • Correlate structure with function:

    • Map mutations onto structural models

    • Identify critical residues for membrane integration versus function

This systematic approach would provide insights into how specific transmembrane regions contribute to tvp23's role in Golgi apparatus function and vesicular transport .

What protein-protein interactions does tvp23 engage in within the Golgi apparatus?

Understanding the interactome of tvp23 is essential for elucidating its molecular function. A comprehensive approach to identifying interaction partners includes:

  • Affinity purification-mass spectrometry:

    • Express tagged tvp23 in A. terreus

    • Carefully solubilize membranes using mild detergents

    • Perform co-immunoprecipitation with appropriate controls

    • Identify binding partners by LC-MS/MS

  • Proximity labeling approaches:

    • Fuse tvp23 with BioID or APEX2 enzymes

    • Allow in vivo labeling of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Targeted validation of interactions:

    • Perform reciprocal co-immunoprecipitation

    • Use fluorescence resonance energy transfer (FRET) for in vivo interaction

    • Apply split-reporter systems (BiFC, split luciferase)

  • Network analysis:

    • Map identified interactions to functional pathways

    • Compare with known Golgi apparatus interaction networks

    • Identify key nodes and potential regulatory mechanisms

Based on homology with TVP23 family proteins, potential interaction partners may include SNARE proteins, coat proteins involved in vesicle formation, small GTPases regulating membrane trafficking, and other structural components of the Golgi apparatus .

How does tvp23 expression vary under different environmental conditions or developmental stages?

Understanding the regulation of tvp23 expression provides insights into its physiological importance. A methodological approach to this question includes:

  • Transcriptomic analysis:

    • Culture A. terreus under various conditions (different growth phases, stress conditions, nutrient limitations)

    • Extract RNA and perform RT-qPCR or RNA-seq analysis

    • Normalize expression against stable reference genes

    • Identify conditions that significantly alter tvp23 expression

  • Protein-level analysis:

    • Generate antibodies against tvp23 or use tagged versions

    • Perform Western blotting to quantify protein levels

    • Assess post-translational modifications by mass spectrometry

  • Promoter analysis:

    • Construct reporter systems with the tvp23 promoter driving fluorescent protein expression

    • Monitor expression patterns in real-time under different conditions

    • Identify potential regulatory elements through bioinformatic analysis

  • Correlation with cellular demands:

    • Relate expression patterns to secretory activity

    • Assess relationship with cell growth and division

    • Investigate potential co-regulation with other Golgi proteins

This approach would elucidate when and how tvp23 expression is regulated, providing insights into its importance during specific cellular states or developmental processes .

What bioinformatic approaches can predict functional domains within the tvp23 protein sequence?

Several computational methods can be employed to identify functional domains and features within tvp23:

  • Sequence-based analyses:

    • Multiple sequence alignment with homologs to identify conserved regions

    • Transmembrane topology prediction using TMHMM, Phobius, or TOPCONS

    • Identification of conserved motifs and functional sites

  • Structural prediction approaches:

    • Secondary structure prediction (alpha helices, beta sheets)

    • Tertiary structure modeling using AlphaFold2 or I-TASSER

    • Molecular dynamics simulations to assess conformational flexibility

  • Evolutionary analysis:

    • Calculation of conservation scores to identify functionally important residues

    • Detection of co-evolving residue pairs suggesting functional coupling

    • Comparison of selection pressure across different regions

  • Domain and motif identification:

    • Search against domain databases (Pfam, InterPro, SMART)

    • Scan for short linear motifs potentially involved in protein-protein interactions

    • Predict post-translational modification sites

The integration of these approaches can generate testable hypotheses about functional regions within tvp23, guiding experimental design for targeted mutagenesis studies .

How can proteomics data be analyzed to identify potential interacting partners of tvp23?

Proteomics approaches generate complex datasets that require sophisticated analysis to identify genuine interaction partners. A methodological workflow includes:

  • Experimental design considerations:

    • Include appropriate controls (non-specific antibody, untagged protein)

    • Perform biological replicates to ensure reproducibility

    • Consider both native and crosslinked conditions to capture transient interactions

  • Mass spectrometry data processing:

    • Perform peptide and protein identification using established databases

    • Apply quantitative approaches (label-free or isotope labeling)

    • Implement statistical filtering to identify significant interactions

  • Data filtration and prioritization:

    • Remove common contaminants and non-specific binders

    • Calculate enrichment scores relative to controls

    • Consider protein abundance to normalize interactions

  • Network construction and analysis:

    • Map identified proteins to interaction databases

    • Apply topological analysis to identify high-confidence interactions

    • Cluster proteins into functional modules

  • Biological interpretation:

    • Perform Gene Ontology enrichment analysis

    • Map interactions to known cellular pathways

    • Identify novel connections for experimental validation

This systematic approach increases confidence in identified interactions and provides a framework for understanding tvp23's role within larger protein complexes and networks .

How can phenotypic data from tvp23 mutants be quantitatively analyzed?

Robust quantitative analysis of phenotypic data requires careful experimental design and statistical approaches:

  • Experimental design considerations:

    • Include appropriate controls (wild-type, empty vector)

    • Use multiple independent mutant strains/clones

    • Standardize growth conditions and data collection methods

    • Collect sufficient biological and technical replicates

  • Phenotypic parameters to quantify:

    • Growth characteristics (rate, morphology, colony size)

    • Cellular ultrastructure with focus on Golgi apparatus

    • Vesicular transport efficiency using fluorescent tracers

    • Protein secretion profiles

  • Advanced imaging approaches:

    • High-content microscopy with automated image analysis

    • Fluorescence recovery after photobleaching (FRAP) for dynamics

    • Live-cell imaging with particle tracking

  • Statistical analysis methods:

    • ANOVA with appropriate post-hoc tests for multiple comparisons

    • Non-parametric tests for non-normally distributed data

    • Principal component analysis for multivariate phenotypes

    • Regression models to identify relationships between variables

  • Data visualization strategies:

    • Box plots or violin plots showing distributions

    • Heatmaps for multiparameter analysis

    • Time-course plots for dynamic processes

This comprehensive approach enables detection of subtle phenotypic effects and provides a quantitative foundation for understanding tvp23 function .

How might CRISPR-Cas technologies further advance the functional characterization of tvp23?

CRISPR-Cas technologies offer several advanced approaches for tvp23 functional characterization:

  • Precision genome editing:

    • Generate clean knockouts without marker genes

    • Create point mutations to test specific functional hypotheses

    • Engineer domain swaps with homologous proteins from other species

    • Introduce conditional alleles for temporal control

  • Regulatable expression systems:

    • Implement CRISPR interference (CRISPRi) for tunable gene repression

    • Apply CRISPR activation (CRISPRa) for controlled overexpression

    • Develop multiplexed editing to study genetic interactions

  • High-throughput screening:

    • Perform saturating mutagenesis of the tvp23 coding sequence

    • Conduct screens for synthetic interactions with other Golgi proteins

    • Identify suppressor mutations that rescue tvp23 loss-of-function

  • Advanced tagging approaches:

    • Precisely integrate split reporters for protein-protein interaction studies

    • Insert degron tags for rapid protein depletion

    • Create conditional alleles for temporal control of tvp23 function

These CRISPR-based approaches would significantly enhance the precision and scope of tvp23 functional studies in A. terreus, providing unprecedented insights into its role in Golgi dynamics .

What comparative genomics approaches could reveal about tvp23 evolution and function?

Comparative genomics offers valuable perspectives on tvp23 evolution and functional conservation:

  • Phylogenetic analysis:

    • Construct comprehensive phylogenetic trees of tvp23 homologs across fungal species

    • Map functional diversification within the TVP23 family

    • Identify lineage-specific adaptations

  • Synteny analysis:

    • Examine conservation of genomic context around tvp23

    • Identify co-evolved gene clusters that might share functional relationships

    • Track chromosomal rearrangements affecting tvp23 loci

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify conserved functional domains

    • Detect signatures of positive selection suggesting adaptive evolution

    • Identify lineage-specific patterns of conservation

  • Correlation with cellular organization:

    • Compare tvp23 sequence features with variations in Golgi structure

    • Examine species-specific adaptations in secretory pathways

    • Link molecular evolution to functional specialization

This evolutionary perspective would place tvp23 in a broader context, potentially revealing functional constraints and adaptations that could inform experimental hypotheses about its role in A. terreus .

How could systems biology approaches integrate tvp23 function into broader Golgi apparatus dynamics?

Systems biology offers frameworks for understanding tvp23 within the complex network of Golgi apparatus functions:

  • Multi-omics integration:

    • Combine proteomics, transcriptomics, and metabolomics data

    • Correlate tvp23 expression/interactions with global cellular states

    • Identify emergent patterns not apparent from single-omics approaches

  • Network analysis:

    • Construct protein-protein interaction networks centered on tvp23

    • Identify network motifs and functional modules

    • Assess network perturbation following tvp23 manipulation

  • Computational modeling:

    • Develop mathematical models of vesicular transport incorporating tvp23

    • Simulate the effects of tvp23 perturbation on Golgi dynamics

    • Refine models iteratively with experimental data

  • Comparative systems analysis:

    • Compare tvp23-centered networks across different fungal species

    • Identify conserved and divergent system properties

    • Link system-level differences to functional specializations

This systems-level perspective would place tvp23 within its broader functional context, potentially revealing emergent properties and relationships that enhance our understanding of Golgi apparatus function in A. terreus .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.