Recombinant Aspergillus terreus Mitochondrial outer membrane protein iml2 (iml2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
iml2; ATEG_00226; Inclusion body clearance protein iml2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-691
Protein Length
full length protein
Species
Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Target Names
iml2
Target Protein Sequence
MFKVGSWLYGKKPGTASTQSLDSLTELRDSATLILNDDVDGAEDGLSEGISSFHNLGRGV VAFIRATLGFEQEIMRQASERLNIAETSAASDQHKAQHNSHAPNTYHSQIYVPGTEFALC QAMAQLMSAVVGVLNESLTESIKGFYKMRKAYITLDGILKMEQKFMQMKRSGELSPPELA QSSSRSSGQGADAKSNPTTPVEAGGLSQKLSELNVSREPTDSDMSVETSSEMLSHDPDSD IFRNQIDVFVHSGANFCFGILLLLISMVPPAFSKLLGIIGFHGDKERGLKMLWQASKFHN LIGAIAAFAMLGYYNGFVRYCDIMPDPVSREEGDVQAYPQERLEALLAKMRKQFPKSQLW LLEESRMEGANKNLERALELLCGEERSPLKQVEALRVFERSLNAMYLHRYQLCSESFIEC VDLNSWSRSLYYYIAGAAHVSLYRSALGKDASEATKHAEQATEYFRTAPPLAGKKRFMAR QLPFDVFVARKIAKWEARAKEWKVPLVDAVGVDPIEEMIFFWNGHSRMTQAHLEESLQHL AWSESDANKHWSREGPEEKAILQLVRAAVLRSMRKHSEAKDLLQRGILDHDKSLFVGHLK DNWIGPAAHFEMAANLWMERPTYIEIHGGPDEENPGEDAHQLERNKVRQCKEYLEKAARW ESYELDARIGLKVTAALEAVHKWETAHSATS
Uniprot No.

Target Background

Function

Recombinant Aspergillus terreus Mitochondrial outer membrane protein iml2 (iml2) is an inclusion body (IB) resident protein exhibiting strong interaction with lipid droplet (LD) proteins. It plays a role in LD-mediated IB clearing following protein folding stress, likely by facilitating access to IBs of an LD-stored soluble sterol derivative functioning as a chaperone in inclusion clearing.

Protein Families
IML2 family
Subcellular Location
Cytoplasm. Nucleus.

Q&A

What is the mitochondrial outer membrane protein iml2 in Aspergillus terreus?

The iml2 protein in A. terreus is a mitochondrial outer membrane protein involved in maintaining mitochondrial morphology and function. Similar to other fungal species, this protein likely participates in protein import machinery and contributes to mitochondrial network integrity. In Aspergillus species, mitochondria typically form an interconnected tubular network that can undergo dramatic morphological changes in response to cellular stress, as observed in A. fumigatus . The iml2 protein plays a critical role in maintaining this dynamic mitochondrial architecture.

Research methods to characterize iml2 include:

  • Fluorescent tagging with GFP for localization studies

  • Knockout studies to observe phenotypic effects on mitochondrial morphology

  • Proteomic analysis of mitochondrial outer membrane fractions

  • Comparative genomic analysis with homologs in other Aspergillus species

What are the optimal expression systems for producing recombinant A. terreus iml2?

Successful expression of recombinant A. terreus iml2 requires careful consideration of expression systems that can accommodate membrane proteins. Based on experiences with similar mitochondrial membrane proteins, the following methodological approaches are recommended:

Expression System Comparison:

Expression SystemAdvantagesLimitationsOptimization Strategies
E. coliRapid growth, high yieldLacks post-translational modifications, inclusion body formationUse specialized strains (C41/C43), lower induction temperature (16-20°C)
Yeast (S. cerevisiae/P. pastoris)Eukaryotic processing, membrane protein machineryLower yields than bacterial systemsOptimize codon usage, use inducible promoters
Filamentous fungi (A. nidulans)Native-like folding environmentComplex cultivation, slower growthUse strong inducible promoters like gpdA
Insect cellsComplex eukaryotic processingHigher cost, technical complexityOptimize viral titer, harvest timing

For mitochondrial targeting in heterologous systems, consider using the N-terminal mitochondrial targeting signal from A. niger citrate synthase (first 59 amino acids), which has been successfully used for targeting proteins to mitochondria in Aspergillus species .

What purification challenges are specific to A. terreus iml2 and how can they be overcome?

Purifying membrane proteins like iml2 presents several challenges:

  • Solubilization strategies:

    • Test a panel of detergents (DDM, LMNG, digitonin)

    • Optimize detergent:protein ratios

    • Consider nanodiscs or SMALPs for native-like membrane environment

  • Chromatography approach:

    • Initial capture: Immobilized metal affinity chromatography (IMAC)

    • Intermediate purification: Ion exchange chromatography

    • Polishing: Size exclusion chromatography

  • Stability enhancement:

    • Include stabilizing lipids (cardiolipin, PE, PC)

    • Use glycerol (10-15%) in purification buffers

    • Maintain cold chain throughout purification

The fragility of mitochondrial morphology observed in A. fumigatus under stress conditions suggests that careful buffer optimization will be critical for maintaining iml2 in its native conformation during purification.

How does iml2 contribute to mitochondrial dynamics in A. terreus?

Mitochondrial dynamics in Aspergillus species involve continuous fission and fusion events that maintain network integrity. Based on studies of mitochondrial morphology in A. fumigatus , we can infer that iml2 in A. terreus likely:

  • Participates in mitochondrial fission/fusion machinery

  • Stabilizes mitochondrial outer membrane curvature

  • Interacts with cytoskeletal elements for mitochondrial movement

  • Contributes to maintaining tubular mitochondrial network structure

Methodology for investigating these functions:

  • Live-cell confocal microscopy with dual fluorescent labeling

  • FRAP (Fluorescence Recovery After Photobleaching) analysis

  • Protein-protein interaction studies (co-IP, BioID)

  • Electron microscopy for ultrastructural analysis

Studies in A. fumigatus have demonstrated that mitochondria form a tubular network under normal conditions but undergo complete fragmentation upon exposure to oxidative stress (≥1.2 mM H₂O₂) . This fragmentation correlates with cell death, suggesting that proteins like iml2 that maintain mitochondrial morphology may be critical for stress resistance.

What role might iml2 play in A. terreus pathogenesis and antifungal resistance?

A. terreus is notably resistant to amphotericin B, distinguishing it from many other Aspergillus species . While the specific contribution of iml2 to this resistance is not well-characterized, mitochondrial proteins may contribute to:

  • Energy metabolism adaptation during host colonization

  • Resistance to host-generated reactive oxygen species

  • Production of secondary metabolites and mycotoxins

  • Stress response coordination during antifungal exposure

Research approaches to investigate these roles:

  • Creation of iml2 knockout strains using CRISPR-Cas9

  • Transcriptomic analysis under infection-mimicking conditions

  • Interaction studies with host immune cells, particularly neutrophils

  • Susceptibility testing of mutant strains to various antifungals

The observation that human granulocytes induce mitochondrial fragmentation in A. fumigatus similarly to H₂O₂ treatment suggests that mitochondrial proteins like iml2 may be involved in the response to immune cell attack during infection.

How can CRISPR-Cas9 genome editing be optimized for studying iml2 in A. terreus?

CRISPR-Cas9 editing in A. terreus requires specialized approaches:

Protocol optimization:

  • Delivery method selection:

    • Protoplast transformation (most common)

    • Agrobacterium-mediated transformation

    • Biolistic transformation

  • Guide RNA design:

    • Target unique regions of iml2 sequence

    • Avoid regions with secondary structures

    • Validate specificity with whole-genome analysis

  • Repair template construction:

    • Include homology arms (≥1 kb for efficient recombination)

    • Consider using selectable markers flanked by LoxP sites for marker recycling

    • Incorporate fluorescent tags for localization studies

  • Screening strategy:

    • PCR verification of integration

    • Western blot confirmation

    • Mitochondrial morphology analysis using fluorescence microscopy

The non-homologous end joining-deficient strains, similar to AfS35 used in A. fumigatus studies , can increase the efficiency of homologous recombination-based editing in A. terreus.

What biophysical techniques are most informative for studying A. terreus iml2 structure-function relationships?

Understanding the structure-function relationship of iml2 requires sophisticated biophysical approaches:

Combining these techniques with functional assays can provide comprehensive insights into how iml2 structure relates to its role in maintaining mitochondrial morphology under various conditions, including stress responses observed in Aspergillus species .

How does iml2 function integrate with the broader metabolic network in A. terreus?

A. terreus is known for producing diverse secondary metabolites through PKS and NRPS pathways . The integration of iml2 function with these metabolic networks can be investigated through:

  • Multi-omics approach:

    • Transcriptomics: RNA-seq to identify co-regulated genes

    • Proteomics: Proximity labeling to identify interaction partners

    • Metabolomics: Targeted analysis of mitochondria-associated metabolites

  • Flux analysis:

    • ¹³C metabolic flux analysis to trace carbon flow

    • Respiratory capacity measurements

    • Mitochondrial membrane potential assessment

  • Network modeling:

    • Construction of protein-protein interaction networks

    • Integration with metabolic models

    • Identification of hub proteins connecting iml2 to other cellular processes

Comparison with A. fumigatus studies on mitochondrial responses to stress could provide insights into how iml2 contributes to metabolic adaptation under different environmental conditions.

What computational approaches can predict functional domains and interaction partners of A. terreus iml2?

Modern computational methods can provide valuable insights into iml2 structure and function:

  • Domain prediction and analysis:

    • SMART, Pfam, and InterPro for identifying conserved domains

    • TMpred and TMHMM for transmembrane region prediction

    • MitoFates for mitochondrial targeting sequence analysis

  • Interaction partner prediction:

    • Interolog mapping based on known interactions in model organisms

    • Co-expression analysis from transcriptomic datasets

    • Structural docking simulations

  • Evolutionary analysis:

    • Phylogenetic profiling across fungal species

    • Selection pressure analysis to identify functionally critical regions

    • Comparative genomics with other Aspergillus species, particularly focusing on the 28 PKS and 20 NRPS gene clusters identified in A. terreus

These computational predictions can guide experimental design for validating iml2 functions and interactions in the context of A. terreus biology and pathogenesis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.