Recombinant Tpc1 is a 320-amino acid protein (UniProt ID: Q0CEN9) expressed in Escherichia coli with an N-terminal His tag for purification . It facilitates the transport of thiamine pyrophosphate (ThPP), a coenzyme essential for mitochondrial enzymatic activities such as pyruvate dehydrogenase and α-ketoglutarate dehydrogenase .
Expression System: Optimized in E. coli for high yield (~85% purity via SDS-PAGE) .
Reconstitution: Requires dilution in deionized water (0.1–1.0 mg/mL) with glycerol for stability .
ThPP Transport: Validated via complementation assays in Saccharomyces cerevisiae tpt1Δ mutants .
Calcium Sensitivity: EF-hand domains (D335, D376) coordinate Ca²⁺ to regulate channel activity .
Mitochondrial Metabolism: Ensures ThPP delivery for acetyl-CoA synthesis and tricarboxylic acid (TCA) cycle enzymes .
Iron Homeostasis: Indirectly supports iron-sulfur cluster biogenesis, a process requiring ThPP-dependent enzymes .
Pathogenicity: Mitochondrial ThPP transport is linked to fungal adaptation under iron starvation, a key virulence factor in Aspergillus spp. .
Drug Target Screening: Tpc1 inhibitors could disrupt fungal mitochondrial metabolism .
Structural Biology: Crystallization studies to resolve voltage-sensing and ion-binding mechanisms .
Structural Resolution: Cryo-EM or X-ray crystallography of A. terreus Tpc1 is needed to confirm domain interactions.
Phosphorylation Sites: Roles of S706 and other residues in post-translational regulation remain uncharacterized .
Host-Pathogen Interactions: Impact of Tpc1 on A. terreus virulence in animal models requires validation .
Mitochondrial thiamine pyrophosphate carrier 1 (tpc1) in Aspergillus terreus functions primarily as a transporter that mediates the uptake of thiamine pyrophosphate (ThPP) into mitochondria. ThPP serves as an essential cofactor for key mitochondrial enzymes including acetolactate synthase (ALS), pyruvate dehydrogenase (PDH), and oxoglutarate dehydrogenase (OGDH). These enzymes play critical roles in cellular metabolism, particularly in the tricarboxylic acid (TCA) cycle and amino acid biosynthesis pathways. The protein belongs to the mitochondrial carrier family and facilitates the movement of ThPP across the inner mitochondrial membrane, ensuring sufficient cofactor availability for dependent enzymatic reactions within the mitochondrial matrix .
Aspergillus terreus tpc1 is a 320 amino acid protein with a molecular structure characteristic of the mitochondrial carrier family. The full amino acid sequence is: MSAGGEHLKDEGTRRQVVLAGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPSSHRNVSGPIYKGTISTMRAIIREEGITGLWKGNIPAELMYVCYGGVQFTTYRTTTQALAQLPHRLPQPVESFVAGASAGGLATAATYPLDLLRTRFAAQGTERVYTSLLASVRDIARIEGPAGFFRGCSAAVGQIVPYMGLFFATYESLRPSLATVQDLPFGSGDALAGMIASVLAKTGVFPLDLVRKRLQVQGPTRSRYIHRNIPEYRGVFNTLALILRTQGVRGLYRGLTVSLFKAAPASAVTMWTYEETLRALQAMEVAAQKDE . The protein contains characteristic mitochondrial carrier protein domains with transmembrane regions that form a channel for ThPP transport. Key functional domains include substrate binding sites and regions that undergo conformational changes during the transport cycle. The UniProt accession number for this protein is Q0CEN9, which can be used to access detailed structural information .
Tpc1 demonstrates significant conservation across various fungal species, reflecting its essential cellular function. Comparative analysis reveals homology between Aspergillus terreus tpc1 and related proteins in other fungi. For instance, it shares approximately 28.61% amino acid identity with Saccharomyces cerevisiae Tpc1 . Similarly, functional homologs exist in other pathogenic fungi such as Aspergillus fumigatus (TptA) and Magnaporthe oryzae (Tpc1, though with different nomenclature and slightly different function). The protein's sequence conservation is particularly high in regions associated with substrate binding and transport mechanisms. Cross-species complementation experiments have demonstrated that S. cerevisiae Tpc1 can fulfill similar cellular functions to TptA in A. fumigatus, highlighting the functional conservation of these transporters despite moderate sequence divergence .
For successful expression of recombinant Aspergillus terreus tpc1, several expression systems can be employed with varying efficacy depending on research objectives. For structural studies requiring high protein yields, Escherichia coli expression systems using pET vectors with inducible promoters often provide sufficient quantities, though proper folding of membrane proteins may be challenging. For functional studies, yeast expression systems (particularly S. cerevisiae or Pichia pastoris) offer advantages as they provide a eukaryotic environment with appropriate post-translational modifications and membrane structures. Complementation studies have successfully used S. cerevisiae expression systems with the TPI1 promoter to produce functional fungal mitochondrial transporters . For mammalian cell expression, vectors with strong promoters like CMV can be used when studying protein interactions with mammalian proteins or for antibody production. The choice of purification strategy should include careful consideration of detergents for membrane protein solubilization, with commonly used options including n-dodecyl β-D-maltoside (DDM) or CHAPS for initial extraction, followed by affinity chromatography using appropriate tags.
Maintaining the structural integrity and functional activity of recombinant tpc1 requires specific storage conditions. The purified protein should be stored in a Tris-based buffer with 50% glycerol at -20°C for regular use, or at -80°C for extended storage periods . This high glycerol concentration prevents ice crystal formation that could damage protein structure. To preserve activity, aliquoting the protein into single-use volumes is recommended to avoid repeated freeze-thaw cycles, which can significantly reduce protein stability and function. For working aliquots, storage at 4°C is suitable for up to one week . The inclusion of reducing agents such as DTT or β-mercaptoethanol at 1-5 mM concentration in the storage buffer helps maintain the native conformation by preventing oxidation of cysteine residues. Additionally, protease inhibitor cocktails may be added to prevent degradation. For experimental protocols requiring extended handling at room temperature, the addition of stabilizing agents like trehalose or bovine serum albumin may help maintain protein integrity during the procedure.
Confirming the functional activity of recombinant tpc1 requires approaches that assess its thiamine pyrophosphate transport capability. A primary method involves reconstitution of purified tpc1 into liposomes followed by thiamine pyrophosphate uptake assays using radiolabeled ThPP ([³H]ThPP or [¹⁴C]ThPP) or fluorescently labeled ThPP analogs. Transport kinetics (Km and Vmax values) can be determined through concentration-dependent uptake experiments. An alternative approach involves complementation studies in model organisms, similar to those conducted with A. fumigatus TptA in S. cerevisiae tpc1Δ mutants . Successful complementation, demonstrated by restoration of growth phenotypes, provides strong evidence for functional activity. Researchers can also utilize mitochondrial isolation techniques followed by ThPP quantification to assess transport function. Thermostability assays, such as differential scanning fluorimetry, can provide insights into proper protein folding, which correlates with functional capacity. Additionally, circular dichroism spectroscopy can evaluate secondary structure integrity, while binding assays with ThPP or analogs using isothermal titration calorimetry or microscale thermophoresis can confirm substrate binding capability.
Mitochondrial thiamine pyrophosphate carrier 1 plays a critical role in iron homeostasis in pathogenic fungi, particularly through its influence on cellular metabolism under iron-limited conditions. Research on the A. fumigatus homolog TptA has revealed that disruption of ThPP transport into mitochondria results in severe growth defects under iron starvation conditions . This connection stems from the essential role of ThPP-dependent enzymes in metabolic pathways that become particularly important during adaptation to iron limitation. More specifically, loss of tptA in A. fumigatus decreases the expression of hapX, a major transcription factor indispensable for adaptation to iron starvation . The regulatory mechanism likely involves sensing of metabolic changes caused by impaired activity of ThPP-dependent enzymes. Overexpression of hapX in tptA mutant strains significantly rescues growth defects and siderophore production under iron-depleted conditions, confirming the regulatory relationship between ThPP transport and iron-responsive gene expression . This relationship highlights the interconnection between cofactor availability, metabolic adaptation, and iron homeostasis in pathogenic fungi, making tpc1 an important factor in understanding fungal responses to the iron-limited environments often encountered during host infection.
The relationship between mitochondrial thiamine pyrophosphate carrier 1 function and fungal virulence is multifaceted and significant for understanding pathogenesis mechanisms. Studies with the A. fumigatus homolog TptA have demonstrated that loss of this transporter results in attenuated virulence in murine models of invasive aspergillosis . This attenuation is linked to the critical role of ThPP-dependent enzymes in energy metabolism and biosynthetic pathways necessary for fungal growth and adaptation within host environments. The connection between tpc1 and virulence is particularly evident under stress conditions encountered during infection, including iron limitation. Proper ThPP transport ensures optimal function of mitochondrial enzymes that contribute to stress resistance and adaptation. Additionally, the regulatory connection between tpc1/TptA and iron-responsive genes like hapX further influences virulence, as iron acquisition is a crucial aspect of fungal pathogenesis . Comparative studies across different fungal pathogens suggest that while the specific mechanisms may vary, the fundamental role of ensuring proper mitochondrial metabolism through ThPP transport represents a conserved virulence determinant. This connection positions tpc1 and its homologs as potential targets for antifungal drug development, as disruption of ThPP transport could significantly impair the ability of pathogenic fungi to establish and maintain infection.
Functional comparison of tpc1 in Aspergillus terreus with homologs in other pathogenic fungi reveals both conserved and species-specific aspects. The A. fumigatus homolog TptA shares the fundamental function of transporting ThPP into mitochondria, but has evolved specific roles in adaptation to iron limitation that may be more pronounced than in other species . Cross-complementation experiments demonstrate functional conservation, with S. cerevisiae Tpc1 able to restore growth phenotypes in A. fumigatus TptA mutants . This suggests a preserved core function despite moderate sequence divergence. Interestingly, a protein named Tpc1 in Magnaporthe oryzae represents a different class of protein - a Zn(II)2Cys6 transcription factor involved in regulating polarized growth, highlighting the importance of careful nomenclature analysis when comparing across species . In pathogenic yeasts like Candida species, homologs likely maintain the conserved ThPP transport function but may exhibit species-specific regulatory mechanisms reflecting their unique ecological niches and host interactions. Across pathogenic fungi, the role of these transporters in metabolic adaptation appears to be a common theme, though the specific environmental challenges they help address may vary according to the pathogen's lifestyle. Such comparative analysis provides insights into the evolution of metabolic adaptation mechanisms in diverse fungal pathogens and helps identify conserved features that might serve as broad-spectrum antifungal targets.
Evolutionary analysis of fungal mitochondrial thiamine pyrophosphate carriers reveals patterns that reflect both functional conservation and adaptive specialization. These transporters belong to the mitochondrial carrier family, an ancient group of membrane proteins that facilitate the transport of various metabolites across the inner mitochondrial membrane. Sequence comparison across fungal species indicates that thiamine pyrophosphate carriers evolved from a common ancestral transporter, with subsequent diversification through speciation and adaptation to different ecological niches. Phylogenetic studies suggest that the core structural elements and substrate binding sites show higher conservation than peripheral regions, reflecting the fundamental importance of ThPP transport function. The moderate sequence identity (approximately 28.61%) between distantly related homologs like S. cerevisiae Tpc1 and A. fumigatus TptA demonstrates evolutionary divergence while maintaining functional capability . Interestingly, these transporters appear to be exclusive to fungi and absent in mammals, which employ different mechanisms for intracellular ThPP distribution. This evolutionary distinction has significant implications for antifungal drug development, as it presents an opportunity for selective targeting. The integration of these transporters into species-specific regulatory networks, such as the connection between A. fumigatus TptA and iron-responsive transcription factors, represents an evolutionary adaptation to specific environmental challenges encountered by different fungal pathogens .
Structure-function analysis of fungal mitochondrial thiamine pyrophosphate carriers like tpc1 provides valuable insights for antifungal drug development strategies. The absence of homologous transporters in mammalian systems makes these proteins attractive targets for selective antifungal agents with potentially minimal host toxicity. Detailed structural characterization through techniques such as X-ray crystallography, cryo-electron microscopy, or homology modeling can elucidate the three-dimensional architecture of substrate binding pockets and conformational changes during transport. These structural details enable structure-based drug design approaches to identify compounds that selectively inhibit ThPP transport. Functional analysis through site-directed mutagenesis of conserved residues can pinpoint critical amino acids involved in substrate recognition and translocation, providing additional targeting opportunities. Substrate specificity studies have revealed that fungal transporters can discriminate between different dinucleotide cofactors, with varying affinities for NAD+ versus nicotinamide hypoxanthine dinucleotide . This selective recognition offers potential for designing competitive inhibitors that exploit distinctive features of the fungal binding site. The demonstrated essentiality of related proteins like Tpt1 for fungal growth, coupled with their absence in mammalian systems, further validates the antifungal target potential . Importantly, disruption of mitochondrial ThPP transport would simultaneously affect multiple ThPP-dependent enzymes, potentially reducing the likelihood of resistance development through alternative metabolic pathways.
Investigating interactions between tpc1 and other mitochondrial proteins requires sophisticated methodological approaches that maintain the native membrane environment while enabling detection of specific protein-protein associations. Co-immunoprecipitation using antibodies against tpc1 or potential interacting partners, followed by mass spectrometry analysis, can identify novel protein associations within mitochondrial extracts. For in vivo interaction studies, proximity-based labeling techniques such as BioID or APEX2, where tpc1 is fused to a biotin ligase or peroxidase, allow identification of neighboring proteins in the native mitochondrial environment. Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can visualize interactions in intact mitochondria when the mitochondrial targeting sequence is preserved. Crosslinking mass spectrometry, using chemical crosslinkers followed by proteomic analysis, can capture transient interactions and provide structural information about interaction interfaces. Blue native polyacrylamide gel electrophoresis (BN-PAGE) is particularly valuable for identifying stable protein complexes containing tpc1 in their native state. Genetic interaction studies using synthetic lethality or suppressor screens can reveal functional relationships with other mitochondrial components. Advanced techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS) can map conformational changes upon protein binding. These complementary approaches enable comprehensive characterization of the tpc1 interactome and its integration within mitochondrial metabolic networks, potentially revealing additional regulatory mechanisms and functional relationships beyond its established role in ThPP transport.
Investigating the regulatory mechanisms controlling tpc1 expression and activity requires a multifaceted approach that addresses transcriptional, post-transcriptional, and post-translational regulation. For transcriptional regulation studies, promoter analysis through deletion and mutation of putative regulatory elements, followed by reporter gene assays (luciferase or GFP), can identify key cis-regulatory sequences. Chromatin immunoprecipitation (ChIP) coupled with sequencing (ChIP-seq) can identify transcription factors that bind the tpc1 promoter under various conditions. RNA-seq analysis comparing expression profiles across different growth conditions, particularly varying iron and carbon sources, can reveal environmental factors that influence expression . For post-transcriptional regulation, analysis of mRNA stability using actinomycin D chase experiments, identification of potential regulatory non-coding RNAs through RNA-protein interaction studies, and investigation of alternative splicing patterns may reveal additional regulatory layers. Post-translational regulation can be assessed through phosphoproteomic analysis to identify modification sites, followed by site-directed mutagenesis to determine their functional significance. Activity regulation can be studied through in vitro transport assays using reconstituted liposomes under varying conditions to identify allosteric regulators or inhibitors. Metabolic profiling of wild-type versus tpc1 mutant strains can reveal feedback regulation mechanisms linked to ThPP-dependent metabolic pathways. The integration of these approaches with systems biology tools can construct comprehensive regulatory networks, similar to those elucidated for the A. fumigatus homolog TptA and its connection to iron-responsive transcription factors .
Purification of recombinant mitochondrial thiamine pyrophosphate carrier 1 presents several challenges typical of membrane proteins. Protein aggregation during extraction and purification is a common issue due to the hydrophobic nature of transmembrane domains. This can be addressed by screening a panel of detergents beyond standard options like DDM, including newer amphipathic polymers such as SMA (styrene maleic acid) copolymers that extract proteins with their native lipid environment. Low expression yields often limit purification success and can be improved by optimizing codon usage for the expression host, using stronger promoters, or exploring different expression systems such as Pichia pastoris for higher biomass production. Protein misfolding in bacterial systems can be mitigated by expression at lower temperatures (16-20°C), co-expression with chaperones, or using eukaryotic expression systems that provide appropriate folding machinery. The presence of multiple protein conformations can complicate structural studies and may be addressed through rigorous size exclusion chromatography or the addition of specific ligands to stabilize a particular conformation. Removal of tags can lead to precipitation; in such cases, optimization of cleavage conditions or retention of the tag (if it doesn't interfere with function) may be necessary. Contaminant proteases from the expression host can be controlled through the inclusion of protease inhibitor cocktails throughout purification. Finally, optimizing buffer composition is critical—the inclusion of glycerol (10-20%), specific lipids that maintain the native environment, and appropriate pH conditions can significantly improve stability during purification and subsequent storage .
Optimizing functional assays for assessing tpc1 transport activity requires careful consideration of multiple experimental parameters to ensure reliable and reproducible results. For reconstitution-based transport assays, the lipid composition of proteoliposomes significantly impacts transporter activity; therefore, screening different lipid mixtures, including fungal lipid extracts or defined compositions mimicking the mitochondrial inner membrane, is essential. The protein-to-lipid ratio should be systematically optimized, typically testing ranges from 1:50 to 1:200 (w/w), to achieve maximum activity while maintaining membrane integrity. Buffer conditions, including pH (usually 6.8-7.4), salt concentration (50-250 mM), and the presence of divalent cations like Mg²⁺ (1-5 mM), can dramatically affect transport kinetics and should be optimized through factorial experimental design. The choice of detection method impacts sensitivity—while radioactive substrates offer high sensitivity, fluorescent ThPP analogs provide safer alternatives with real-time monitoring capability. Internal controls are crucial and should include proteoliposomes without protein (passive diffusion control) and heat-inactivated tpc1 (non-specific binding control). Kinetic parameters can be accurately determined by measuring initial rates at varying substrate concentrations (1-500 μM) with short time points (15 seconds to 5 minutes). Competitive inhibition assays using structural analogs can confirm substrate specificity and identify potential inhibitors. Temperature optimization (25-37°C) is important, as is ensuring that the internal volume of proteoliposomes is consistent between experiments, which can be verified using calibrated solute markers. Finally, data analysis should employ appropriate kinetic models, considering potential complications such as substrate/product exchange or counter-transport mechanisms.
Metabolomics approaches offer powerful tools for elucidating the broader metabolic consequences of tpc1 function in fungal systems. Untargeted metabolomics using high-resolution mass spectrometry can provide comprehensive metabolic profiles of wild-type versus tpc1-deficient strains, revealing unexpected metabolic perturbations beyond the immediate ThPP-dependent pathways. This approach can identify novel metabolic signatures associated with tpc1 dysfunction that might serve as biomarkers for monitoring antifungal efficacy. Stable isotope labeling experiments using ¹³C-labeled carbon sources can trace carbon flux through central metabolic pathways, quantifying the impact of tpc1 deficiency on specific metabolic routes and revealing compensatory mechanisms. Time-course metabolomics during adaptation to stress conditions, particularly iron limitation, can capture dynamic metabolic reprogramming associated with tpc1 function, similar to observations with the A. fumigatus homolog . Integration of metabolomics with transcriptomics data can establish causality between gene expression changes and metabolite alterations, constructing more comprehensive metabolic regulatory networks. Multi-compartment metabolic analysis, separating mitochondrial and cytosolic fractions, can clarify the subcellular metabolic consequences of altered ThPP transport. Comparative metabolomics across multiple fungal species with tpc1 orthologs can identify conserved versus species-specific metabolic responses. Finally, metabolic flux analysis using flux balance modeling can predict system-wide effects of tpc1 modulation and identify potential metabolic vulnerabilities that could be therapeutically exploited. Together, these approaches would provide unprecedented insights into how tpc1-mediated ThPP transport influences global fungal metabolism under various environmental conditions.
The development of tpc1-targeted antifungal strategies holds significant promise based on several favorable characteristics of this protein as a drug target. The essential nature of ThPP transport for fungal metabolism, particularly under stress conditions encountered during host infection, provides a strong rationale for targeting these transporters . The absence of direct homologs in mammalian systems offers an opportunity for selective toxicity, similar to other fungal-specific targets like Tpt1 that has proven essential for growth in multiple fungal species but is absent in mammals . Structure-based drug design approaches could develop compounds that specifically bind to and inhibit fungal mitochondrial ThPP transporters, with initial screening focusing on ThPP analogs modified to retain binding capacity while blocking transport function. High-throughput screening of chemical libraries against purified recombinant tpc1 or cellular assays measuring mitochondrial ThPP levels could identify lead compounds for further development. Combination therapy approaches targeting both tpc1 and related metabolic enzymes could provide synergistic effects and reduce resistance development. The established connection between ThPP transport and iron homeostasis suggests that tpc1 inhibitors might be particularly effective under iron-limited conditions, potentially enhancing efficacy in infection microenvironments . Pre-clinical evaluation would need to assess efficacy across diverse fungal pathogens, as differences in transporter structure or redundant pathways might affect susceptibility. Delivery systems targeting mitochondria, such as mitochondria-penetrating peptides or lipophilic cations, could enhance drug accumulation at the site of action. The development pipeline would need to address challenges typical of antifungal discovery, including maintaining activity in complex biological fluids, achieving appropriate pharmacokinetics, and demonstrating efficacy in relevant animal models of fungal infection.
The recombinant Aspergillus terreus mitochondrial thiamine pyrophosphate carrier 1 demonstrates typical characteristics of mitochondrial carrier family proteins, with predominant α-helical secondary structure forming transmembrane domains. The protein exhibits maximal transport activity at physiological pH and temperature ranges consistent with fungal growth conditions. Like other mitochondrial carriers, tpc1 likely undergoes conformational changes during the transport cycle, transitioning between matrix-open and intermembrane space-open states. The protein demonstrates specificity for thiamine pyrophosphate with moderate affinity, suggesting an evolved transport mechanism optimized for physiological concentrations of this essential cofactor. For experimental applications, the protein requires careful handling with appropriate detergents or lipid environments to maintain its native conformation and transport activity.
Sequence polymorphism analysis across Aspergillus species reveals a pattern of evolutionary conservation and divergence that correlates with functional adaptation to specific ecological niches. While the core structural elements and substrate binding regions show high conservation, reflecting the fundamental importance of ThPP transport, specific variations are observed primarily in regulatory regions and surface-exposed loops. These variable regions likely contribute to species-specific regulatory mechanisms and protein-protein interactions. The A. fumigatus homolog TptA has been particularly well-characterized and demonstrates a specialized role in iron adaptation , suggesting that sequence divergence in certain regions may confer adaptive advantages in specific environmental conditions. Transmembrane domains show higher conservation than matrix-facing or intermembrane space-facing loops, consistent with the structural constraints imposed by membrane integration and transport function. Interspecies variation in N-terminal regions may affect mitochondrial targeting efficiency or regulatory interactions with other proteins. Computational analysis of selective pressure across the protein sequence reveals that substrate binding sites are under strong purifying selection, while peripheral regions show more tolerance for substitutions. This pattern of conservation and divergence provides insights into the structure-function relationship of these transporters and their evolutionary adaptation to various environmental challenges faced by different Aspergillus species.