Recombinant Aspergillus terreus Patatin-like phospholipase domain-containing protein ATEG_02594 (ATEG_02594)

What is the basic structure and function of ATEG_02594 protein?

ATEG_02594 is a patatin-like phospholipase domain-containing protein from Aspergillus terreus. The full-length protein consists of 715 amino acids with the following sequence: MTDSAIGNVYDPRALPDYDREFIHPDDLRRFENALNDQDVLPLVALNDWRPVYQRVRKTRGRRKEPRRTKDETREGVLYTVLKWPFLAFVLGWISFLGVAYILTRFYIFIYEQWVSWRGKRQSLRKQLYVQTNYRDWLKAAEALDAHLGNHAWKEIDENAYYDHITINKLVSQLRKLRQDAEWEMHHEQVNAAESPAVEELCTILEACVKNNFAGVENPRLYSETYSGTKVLVQEYVDEVKACLELVAESKQISDEDKYHHFKHLDTNFGRTALCLSGGATFAYYHFGVVRALLDNNVLPEIITGTSGGALVAALVATRTDEELKQLLVPALAHRIRACHEGFTTWVRRWWRTGARFDTLEWARQCSWFCRGSTTFREAYERTGRILNVSCVPSDPHSPTILANYLTSPNCVIWSAVLASAAVPGILNPVVLMTKKRDGTLAPYSFGHKWKDGSLRTDIPIKALNLHFNVNFTIVSQVNPHINLFFFSSRGAVGRPVTHRKGRGWRGGFLGSAIEQYIKLDMNKWLRVLRHLELLPRPMGQDWSEIWLQKFSGTVTIWPKTVPSDFYYILSDPTPERLARMIHMGQQSAFPKIQFIKNRLKIEYAIIKGLQQTAPRGGGRATSPTQLRLRNGHGNGPVNPIDERLDQNLPERTGEYSKEAD ANSAEMSDSSGVDSATASALREARHPRRNSMLVEMQRQSAVFFDDVDSDTWKGQ . As a patatin-like phospholipase, it likely functions in lipid metabolism and may play roles in fungal pathogenicity through interaction with host cell membranes.

How is recombinant ATEG_02594 typically produced for research applications?

Recombinant ATEG_02594 is typically produced in E. coli expression systems with an N-terminal His tag to facilitate purification . The methodology involves:

• Cloning the full-length ATEG_02594 gene sequence into an appropriate expression vector

• Transforming the construct into a suitable E. coli strain

• Inducing protein expression under optimized conditions

• Lysing cells and purifying the His-tagged protein using affinity chromatography

• Processing the purified protein into a lyophilized powder form

Researchers should verify protein quality through SDS-PAGE (ensuring >90% purity) and consider appropriate storage conditions (-20°C/-80°C) with recommended reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage .

What is the significance of studying ATEG_02594 in the context of Aspergillus terreus infections?

Studying ATEG_02594 is particularly significant because A. terreus is an emerging fungal pathogen associated with invasive aspergillosis (IA) in immunocompromised patients . Research on this protein may provide insights into:

• Pathogenesis mechanisms specific to A. terreus infections

• The high rate of dissemination observed in A. terreus infections (occurring in 63% of patients)

• Relationships to the intrinsic amphotericin B resistance of A. terreus

• Potential novel therapeutic targets for treating resistant infections

Understanding ATEG_02594 may contribute to addressing the poor outcomes associated with A. terreus infections, particularly in specialized populations such as leukemia patients, where standard antifungal treatments often show limited efficacy .

What reconstitution and storage protocols are recommended for recombinant ATEG_02594?

For optimal experimental outcomes, researchers should follow these methodological guidelines:

• Storage preparation:

  • Briefly centrifuge the vial before opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add 5-50% glycerol (final concentration) for long-term storage

  • Aliquot to avoid repeated freeze-thaw cycles

• Storage conditions:

  • Store at -20°C/-80°C for long-term preservation

  • Keep working aliquots at 4°C for up to one week

  • Store in Tris/PBS-based buffer with 6% trehalose at pH 8.0

Repeated freeze-thaw cycles should be strictly avoided as they can compromise protein integrity and experimental reproducibility.

How does ATEG_02594 potentially contribute to amphotericin B resistance in A. terreus?

Aspergillus terreus exhibits intrinsic resistance to amphotericin B, contributing to its high mortality rate in invasive infections . While the direct role of ATEG_02594 in this resistance has not been fully characterized, patatin-like phospholipase domain-containing proteins can influence membrane composition and integrity. Methodological approaches to investigate this relationship include:

• Gene knockout/knockdown studies of ATEG_02594 followed by amphotericin B susceptibility testing

• Comparative membrane lipid profiling between wild-type and ATEG_02594-modified strains

• Protein localization studies to determine membrane association during antifungal exposure

• Recombinant protein interaction studies with amphotericin B and membrane components

Research design should incorporate appropriate controls including A. fumigatus isolates (typically amphotericin B-susceptible) and multiple A. terreus clinical isolates to account for strain diversity .

What approaches can be used to study the enzymatic activity of ATEG_02594?

To characterize the enzymatic activity of ATEG_02594 as a patatin-like phospholipase, researchers should employ multiple complementary methodologies:

• Substrate specificity assays:

  • Test various phospholipid substrates (phosphatidylcholine, phosphatidylethanolamine, etc.)

  • Monitor product formation using HPLC, mass spectrometry, or colorimetric assays

  • Determine kinetic parameters (Km, Vmax, kcat) under different conditions

• Structure-function analysis:

  • Site-directed mutagenesis of predicted catalytic residues

  • Domain deletion/swapping experiments

  • Protein crystallography to determine three-dimensional structure

• Inhibitor studies:

  • Screen known phospholipase inhibitors

  • Develop specific inhibitors through rational design

  • Assess inhibitory effects on fungal growth and pathogenicity

Statistical analysis of enzymatic data should employ appropriate methods like ANOVA for comparing activity across multiple conditions, with post-hoc tests to identify specific differences between experimental groups .

How might ATEG_02594 interact with host immune responses during A. terreus infection?

Investigating the immunomodulatory properties of ATEG_02594 requires examining interactions between the recombinant protein and immune cells. Methodologically, researchers should:

• Assess cytokine induction in response to ATEG_02594 exposure:

  • Measure pro-inflammatory cytokines (TNFα, IL-1β) in human monocytes

  • Compare responses between healthy donors and immunocompromised patients

  • Evaluate dose-dependent effects

• Examine potential modulation of interferon-γ (IFNγ) responses:

  • Test whether ATEG_02594 affects IFNγ-mediated enhancement of fungal killing

  • Assess changes in cytokine production in presence/absence of recombinant IFNγ

• Investigate effects on neutrophil and macrophage function:

  • Phagocytosis assays

  • Respiratory burst measurements

  • NET (neutrophil extracellular trap) formation analysis

Results should be analyzed using paired statistical tests when comparing pre- and post-treatment responses from the same subjects, as demonstrated in studies of adjunctive IFNγ therapy .

What are key considerations for designing experiments to study ATEG_02594 function?

Designing rigorous experiments to study ATEG_02594 requires careful planning and appropriate controls:

• Expression system selection:

  • Consider potential differences in post-translational modifications between E. coli and fungal expression systems

  • Evaluate effects of N-terminal His tag on protein folding and function

  • Include tag-free protein controls where feasible

• Experimental conditions optimization:

  • Buffer composition (pH, salt concentration, divalent cations)

  • Temperature and reaction time

  • Protein concentration and stability assessment

• Model system selection:

  • In vitro enzymatic assays

  • Cell culture models (fungal, human cell lines)

  • Animal models of invasive aspergillosis

• Controls and validations:

  • Include enzyme-dead mutants as negative controls

  • Use known phospholipases as positive controls

  • Validate antibody specificity for detection methods

Statistical design should incorporate power analysis to determine appropriate sample sizes and include biological (not just technical) replicates to account for natural variation .

How can researchers effectively study ATEG_02594 in the context of A. terreus pathogenicity?

To investigate the role of ATEG_02594 in pathogenicity, researchers should implement a multi-faceted approach:

• Genetic manipulation strategies:

  • Generate knockout mutants using CRISPR-Cas9 or traditional homologous recombination

  • Create complemented strains to confirm phenotype specificity

  • Develop conditional expression systems for essential genes

• Virulence assessment models:

  • Standardized in vitro assays (biofilm formation, invasion assays)

  • Galleria mellonella infection model for initial screening

  • Murine models of invasive aspergillosis with immunosuppression protocols

• Tissue tropism and dissemination analysis:

  • Organ fungal burden quantification

  • Histopathological examination

  • In vivo imaging using fluorescently labeled fungi

• Comparative analysis:

  • A. terreus wild-type vs. ATEG_02594 mutants

  • A. terreus vs. A. fumigatus comparisons

  • Multiple clinical isolates to account for strain variation

Research design should consider the high dissemination rate (63%) observed in clinical A. terreus infections and incorporate appropriate methodologies to assess this aspect of pathogenicity .

What statistical approaches are most appropriate for analyzing ATEG_02594 experimental data?

Selecting appropriate statistical methods is crucial for robust data analysis in ATEG_02594 research:

• For comparing two experimental groups:

  • Student's t-test for independent samples with normal distribution

  • Paired t-test for before/after comparisons on the same samples

  • Mann-Whitney U test for non-parametric data

• For multi-group comparisons:

  • One-way ANOVA for comparing means across three or more groups

  • Kruskal-Wallis test for non-parametric multiple group comparisons

  • Post-hoc tests (Tukey, Bonferroni) to identify specific group differences

• For categorical data analysis:

  • Chi-square test for comparing frequencies

  • Fisher's exact test for small sample sizes

  • McNemar's test for paired nominal data

• For complex experimental designs:

  • Factorial ANOVA for experiments with multiple factors

  • Repeated measures ANOVA for time-course experiments

  • Mixed-effects models for nested or hierarchical data

Researchers should verify that data meet test assumptions (normality, homogeneity of variance) and consider data transformations when necessary. Power analysis should be conducted prior to experimentation to ensure adequate sample sizes .

How should researchers address potential contamination issues in ATEG_02594 recombinant protein preparation?

Contamination in recombinant protein preparations can significantly impact experimental results. Researchers should implement the following methodological approach:

• Rigorous quality control procedures:

  • SDS-PAGE analysis to confirm >90% purity

  • Western blot verification of protein identity

  • Mass spectrometry analysis for precise molecular weight confirmation

  • Endotoxin testing for E. coli-derived preparations

• Contamination assessment protocol:

  Test	Method	Acceptance Criteria
  Purity	SDS-PAGE	>90% single band
  Identity	Western blot/MS	Matches predicted MW
  Endotoxin	LAL assay	<0.1 EU/μg protein
  Microbial	Culture-based	No growth
  DNA	qPCR	<10 ng/mg protein

• Data interpretation guidelines:

  • Compare results with multiple protein preparations

  • Include appropriate controls (buffer-only, irrelevant proteins)

  • Consider dose-dependent effects to distinguish specific from non-specific responses

  • Validate key findings with complementary approaches (genetic models, alternative protein sources)

How can researchers reconcile conflicting data regarding ATEG_02594 function in different experimental systems?

Conflicting experimental results may occur when studying ATEG_02594 across different systems. A systematic approach to addressing these conflicts includes:

• System-specific variable identification:

  • Expression system differences (E. coli vs. fungal)

  • Post-translational modification variations

  • Buffer and reaction condition disparities

  • Species-specific interaction partners

• Methodological reconciliation:

  • Standardize protein preparation and handling protocols

  • Use multiple complementary techniques to assess function

  • Cross-validate findings between in vitro and cellular systems

  • Employ native and recombinant protein comparisons

• Data integration framework:

  • Develop a hierarchical model that accommodates system-specific findings

  • Consider contextual factors (pH, temperature, ionic strength)

  • Build computational models to predict context-dependent functions

  • Design targeted experiments to test conflicting hypotheses directly

What approaches can resolve discrepancies between in vitro ATEG_02594 studies and clinical A. terreus infection observations?

Translating in vitro findings to clinical relevance requires methodological bridges:

• Clinical isolate characterization:

  • Sequence ATEG_02594 from multiple clinical isolates

  • Assess variation in expression levels during infection

  • Compare enzymatic properties between recombinant and native proteins

• Ex vivo experimental models:

  • Human blood infection models

  • Precision-cut lung slice infections

  • Primary immune cell interaction studies

• Biomarker correlation studies:

  • Measure ATEG_02594-related biomarkers in patient samples

  • Correlate with clinical outcomes and treatment responses

  • Analyze galactomannan levels in relationship to ATEG_02594 activity

• Integrated analysis approach:

  Level	Experimental System	Clinical Parameter	Correlation Method
  Molecular	Enzyme activity	Antifungal resistance	Regression analysis
  Cellular	Host cell damage	Tissue invasion	Path analysis
  Organism	Animal mortality	Patient outcomes	Survival analysis

• Therapeutic implications assessment:

  • Test whether IFNγ therapy affects ATEG_02594 expression or function

  • Evaluate novel antifungals (CD101, olorofim, PC945) against ATEG_02594-expressing strains

  • Investigate potential for ATEG_02594-targeted therapeutics

What novel approaches could advance understanding of ATEG_02594's role in A. terreus virulence?

Exploring cutting-edge methodologies may provide new insights into ATEG_02594 function:

• Advanced genetic approaches:

  • CRISPR interference for temporal control of gene expression

  • Single-cell transcriptomics to assess heterogeneity in expression

  • Conditional protein degradation systems for acute functional studies

• Structural biology integration:

  • Cryo-EM analysis of protein-membrane interactions

  • Hydrogen-deuterium exchange mass spectrometry for dynamics

  • Computational modeling of substrate interactions

• Host-pathogen interface analysis:

  • Dual RNA-seq during infection

  • Proteomics of the host-pathogen interface

  • Live cell imaging of protein localization during infection

• Systems biology framework:

  • Network analysis of ATEG_02594 interactors

  • Metabolomic profiling of ATEG_02594 mutants

  • Multi-omics integration to develop comprehensive models

Research should prioritize clinical relevance, particularly focusing on the high dissemination rate (63%) and poor outcomes associated with A. terreus infections, especially in patients with hematological malignancies .

How might understanding ATEG_02594 contribute to novel therapeutic approaches for A. terreus infections?

Translating ATEG_02594 research into therapeutic applications requires considering multiple strategic approaches:

• Direct inhibitor development:

  • Structure-based design of specific ATEG_02594 inhibitors

  • High-throughput screening of chemical libraries

  • Peptide-based inhibitor development

• Immunomodulatory strategies:

  • Combining ATEG_02594 inhibitors with adjunctive IFNγ therapy

  • Assessing effects on cytokine responses (TNFα, IL-1β)

  • Evaluating enhancement of fungal killing by immune cells

• Combination therapy optimization:

  • Testing synergy with novel antifungals (CD101, olorofim, PC945)

  • Overcoming amphotericin B resistance mechanisms

  • Developing biomarker-guided treatment algorithms

• Resistance monitoring framework:

  • Developing assays for ATEG_02594 activity in clinical samples

  • Monitoring expression levels during treatment

  • Correlating genetic variants with treatment outcomes

Research should build upon evidence that adjuvant immunotherapy with IFNγ improved outcomes in refractory invasive A. terreus infections through enhanced monocyte function and fungal killing capacity .