Recombinant Aspergillus terreus Protein get1 (get1)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Aspergillus terreus Protein get1

Recombinant Aspergillus terreus Protein get1 (get1) is a bioengineered version of the native protein encoded by the get1 gene in Aspergillus terreus. It is expressed in Escherichia coli and functions as a receptor for soluble Get3 (TRC40 in humans), mediating the post-translational insertion of tail-anchored (TA) proteins into the endoplasmic reticulum (ER) membrane .

Expression and Purification

Purification Steps

  1. Nickel Affinity Chromatography: Utilizes the His-tag for selective binding .

  2. Gel Filtration: Confirms monomeric state .

Functional Role in Cellular Biology

Mechanism of Action
The Get1/2 complex forms an aqueous channel (~20 Å diameter) in lipid bilayers, enabling the translocation of TA proteins into the ER membrane . This process involves:

  1. Recognition: Get3 binds the TA protein’s transmembrane domain (TMD).

  2. Delivery: Get3 shuttles the TA protein to the Get1/2 receptor.

  3. Insertion: The Get1/2 channel facilitates TMD partitioning into the ER membrane .

Key Research Findings

Study FocusOutcomeMethodologySource
Channel FormationGet1/2 creates a ~20 Å pore in bilayersBulk fluorescence, microfluidics
TA Protein SpecificityMediates insertion of cytosolic TA proteinsBiochemical assays

Research Applications

Potential Uses

  • Biochemical Studies: Investigating ER membrane dynamics and protein trafficking .

  • Structural Biology: Elucidating the Get1/2 channel architecture .

  • Therapeutic Targets: Exploring roles in fungal pathogenesis or protein biogenesis.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
get1; ATEG_05589; Protein get1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Target Names
get1
Target Protein Sequence
MLSLIWTVFFVHVAIYLINTIGASTIDGLLWLLYLKLPTSTSKCAQEQTRLKREVVQLKR EMNNTSSQDEFAKWAKIRRRHDKTMEEYEKINKTLNAQKTSFDWSVKIARWLSTNGLKIF LQFWYSKTPVFALPQAWFPYYVEWVLSFPRAPMGSVSIQVWSNVCATAISVLAEIVTAAF MQMASRTAVPVAAEDKKEL
Uniprot No.

Target Background

Function
Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. It functions as a membrane receptor for soluble Get3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol.
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is GET1 and what is its primary function?

GET1 (Guided Entry of Tail-anchored proteins 1) is a transmembrane protein that functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of tail-anchored (TA) proteins in the cytosol. GET1 is required for the post-translational delivery of TA proteins to the endoplasmic reticulum . The GET1/2 complex forms an insertase that facilitates the integration of these proteins into the ER membrane following their delivery by GET3 .

How does the GET pathway function in protein targeting?

The GET pathway facilitates the targeting of tail-anchored proteins to the endoplasmic reticulum. In this pathway, GET3 recognizes and binds to the transmembrane domain of TA proteins in the cytosol, and then delivers them to the GET1/2 transmembrane complex at the ER membrane. The GET1/2 complex then mediates the insertion of these TA proteins into the membrane. This process is essential for proper localization of many important cellular proteins that contain a single C-terminal transmembrane domain .

What happens when GET1 function is disrupted?

Disruption of GET1 function leads to defects in TA protein insertion, which can result in cytosolic aggregation of these proteins. Studies using a GFP cell reporter of heat shock factor transcriptional activity have shown that mutations in the GET1/2 transmembrane domain result in elevated heat shock factor activity, indicating cellular stress due to protein mislocalization . The severity of this phenotype varies depending on the specific mutations introduced.

What methods are used to study GET1 function in vitro?

Several experimental approaches can be used to study GET1 function:

  • In vitro transcription and translation: Capped mRNAs for TA proteins like Sec22 and Sbh1 can be in vitro transcribed using kits such as mMessage mMachine T7 and then translated in the presence of 35S-methionine in cell extracts supplemented with GET3FLAG and GET4-GET5 .

  • TA protein insertion assays: Insertion of TA proteins into microsomes can be monitored by glycosylation and quantified by phosphorimager analysis .

  • Crosslinking experiments: Site-specific crosslinking can be used to trap intermediates during the insertion process, providing insights into the mechanism of GET1-mediated protein insertion .

  • Single-chain GET1/2 constructs: Engineering a single-chain version of the GET1/2 heterodimer (GET2-1sc) allows for the study of specific transmembrane segments without disrupting the entire complex .

How can recombinant GET1 protein be expressed and purified?

Recombinant GET1 can be expressed using cell-free expression systems, which is particularly advantageous for transmembrane proteins like GET1 . For functional studies, GET1 is often co-expressed with GET2, as they form a functional complex in vivo. The purified protein can be used for structural studies, biochemical assays, and reconstitution experiments to study the mechanism of TA protein insertion.

Expression SystemAdvantagesChallengesApplications
Cell-free systemAvoids toxicity issues, rapidLower yieldsInitial characterization
Bacterial expressionHigher yields possibleProtein folding issuesBiochemical studies
Yeast expressionNative post-translational modificationsMore complex systemFunctional studies
Insect/mammalian cellsBetter for complex proteinsExpensive, time-consumingStructural studies

What genetic approaches can be used to study GET1 function in vivo?

Several genetic approaches have been employed to study GET1 function:

  • Gene replacement: The GET1 gene can be replaced with mutant versions to study the effect of specific mutations on protein function .

  • Promoter swap: The native promoter driving GET1 expression can be replaced with stronger promoters like the TDH3 promoter to increase expression levels .

  • Engineering cysteine mutations: Introduction of cysteine residues at specific positions in GET1 allows for site-specific crosslinking experiments to study protein-protein interactions .

  • Single-chain GET1/2 fusion: GET1 can be fused to GET2 using amino acid linkers to create a single protein that maintains the functionality of the complex .

How do mutations in the GET1 transmembrane domain affect its function?

Mutations in the GET1 transmembrane domain can significantly disrupt its function. Research has shown that replacing the transmembrane segments of GET1/2 with those from unrelated ER membrane proteins (such as Sec61β or Ost4) results in loss of function, as evidenced by elevated heat shock factor activity . Additionally, mutation of conserved residues, such as an aspartic acid residue near the middle of GET2 TM3 (D271K), can severely destabilize the GET1/2 complex .

What is known about the interaction between GET1 and GET3?

GET1 acts as a membrane receptor for soluble GET3, which is loaded with TA protein substrates. This interaction is critical for the delivery and insertion of TA proteins into the ER membrane. The cytosolic domains of GET1 interact with GET3, while the transmembrane domains of GET1 and GET2 form the insertion site for the TA protein transmembrane domain. Disruption of the GET1/2 transmembrane domain prevents efficient TA protein insertion, even when the cytosolic domains are intact, suggesting that both domains are essential for function .

How does the GET1/2 complex mediate TA protein insertion?

The insertion of TA proteins by the GET1/2 complex occurs through a multi-step process:

  • GET3 delivers the TA protein to the GET1/2 complex at the ER membrane.

  • The TA protein transmembrane domain is transferred from GET3 to the GET1/2 insertase.

  • The GET1/2 complex facilitates the insertion of the TA protein into the lipid bilayer.

Experimental evidence for this pathway has been obtained using crosslinking approaches, which have captured intermediates during the insertion process. These studies have shown that the insertion process is rapid and transient under normal conditions, but can be arrested by introducing roadblocks such as an S-protein attachment to the TA protein .

How can one distinguish between GET-dependent and GET-independent TA protein insertion pathways?

To distinguish between GET-dependent and GET-independent TA protein insertion pathways, researchers can employ several approaches:

  • Genetic approaches: Create GET1/GET2/GET3 deletion strains and assess the insertion efficiency of various TA proteins. GET-dependent TA proteins will show reduced insertion in these strains, while GET-independent TA proteins will be inserted normally.

  • Biochemical competition assays: In vitro insertion assays can be performed in the presence of excess amounts of known GET-dependent TA proteins. If insertion of a test protein is competed out, it likely uses the same pathway.

  • Structural analysis of the TA domain: The hydrophobicity and length of the transmembrane domain, along with the charge distribution in flanking regions, can predict whether a TA protein is likely to use the GET pathway.

  • Crosslinking studies: Site-specific crosslinking between TA proteins and components of different insertion pathways can provide direct evidence for pathway utilization .

What are the experimental challenges in studying membrane protein insertases like GET1/2?

Studying membrane protein insertases like GET1/2 presents several challenges:

  • Protein expression and purification: Membrane proteins are notoriously difficult to express and purify in functional form due to their hydrophobic nature and requirement for a lipid environment.

  • Reconstitution of activity: In vitro reconstitution of membrane protein insertion requires properly formed liposomes or microsomes with the correct lipid composition.

  • Capturing transient intermediates: The insertion process is rapid and transient, making it difficult to capture intermediates without artificial roadblocks or crosslinking strategies .

  • Structural studies: Obtaining high-resolution structures of membrane protein complexes like GET1/2 is challenging due to their flexibility and hydrophobic nature.

  • Distinguishing on-pathway from off-pathway intermediates: It's crucial to verify that observed intermediates are genuine on-pathway intermediates rather than artifacts of the experimental system .

How might the function of GET1 differ in Aspergillus terreus compared to other organisms?

While specific information on GET1 in Aspergillus terreus is limited, several hypotheses can be proposed based on the known attributes of this fungal species:

  • Secondary metabolite production: A. terreus is known for producing various secondary metabolites, including lovastatin, sulochrin, and terretonin . The GET pathway might be particularly important for the insertion of TA proteins involved in these biosynthetic pathways.

  • Pathogenicity factors: As an emerging pathogen affecting immunocompromised patients , A. terreus may have specific TA proteins related to virulence that require the GET pathway for proper localization.

  • Stress adaptation: A. terreus produces accessory conidia (AC) that differ from primary conidia (PC) and may play an important role during infection . The GET pathway might be differentially regulated during different developmental stages or under stress conditions.

  • Genome mining potential: Analysis of the A. terreus genome has revealed numerous polyketide synthase (PKS) and non-ribosomal peptide synthetase (NRPS) genes , which may include TA proteins requiring GET1 for proper insertion.

What controls should be included when studying recombinant GET1 function?

When studying recombinant GET1 function, several controls should be included:

  • Negative controls:

    • GET1 deletion strains or cells expressing non-functional GET1 mutants

    • Incubation with non-GET-dependent TA proteins

    • Reactions lacking ATP or other required components

  • Positive controls:

    • Wild-type GET1 expressed under the same conditions as experimental constructs

    • Known GET-dependent TA proteins like Sec22 or Sbh1

    • Complete reaction mixtures with all required components

  • Specificity controls:

    • Testing insertase-defective GET1/2 mutants to ensure observed effects are specific to functional GET1

    • Using TA proteins with mutations in their transmembrane domains to test sequence specificity

How can the interaction between GET1 and specific tail-anchored proteins be validated?

The interaction between GET1 and specific tail-anchored proteins can be validated through several approaches:

  • Crosslinking experiments: Site-specific crosslinkers can be introduced at various positions in GET1 and the TA protein to capture direct interactions. This approach has been successfully used to demonstrate the interaction between GET1 TM1 and the Sec22 TMD during insertion .

  • Co-immunoprecipitation: Antibodies against GET1 can be used to co-precipitate interacting TA proteins, or vice versa.

  • Fluorescence resonance energy transfer (FRET): Fluorescent tags can be attached to GET1 and TA proteins to detect proximity-based energy transfer.

  • Surface plasmon resonance (SPR): Purified GET1 (usually as part of the GET1/2 complex) can be immobilized on a sensor chip, and the binding kinetics of different TA proteins can be measured.

  • Genetic approaches: Suppressor screens can identify mutations in TA proteins that restore function in the presence of GET1 mutations, indicating direct interaction.

What strategies can improve the expression and stability of recombinant GET1?

Several strategies can improve the expression and stability of recombinant GET1:

  • Codon optimization: Adapting the GET1 coding sequence to the codon usage of the expression host can improve translation efficiency.

  • Co-expression with GET2: Since GET1 and GET2 form a complex in vivo, co-expression may improve stability and folding.

  • Fusion tags: N- or C-terminal fusion tags like His6, GST, or MBP can improve solubility and facilitate purification.

  • Detergent screening: Testing various detergents and lipids for protein extraction and purification can identify conditions that maintain GET1 in a functional state.

  • Directed evolution approaches: Random or site-directed mutagenesis followed by selection for improved expression can identify GET1 variants with enhanced stability.

  • Single-chain constructs: Engineering a single-chain version of the GET1/2 complex, as demonstrated in research, can improve stability while maintaining function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.