Recombinant Aspergillus terreus Vacuolar ATPase assembly integral membrane protein VMA21 (vma21)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Aspergillus terreus Vacuolar ATPase Assembly Integral Membrane Protein VMA21 (vma21)

Recombinant Aspergillus terreus Vacuolar ATPase assembly integral membrane protein VMA21 (vma21) is a synthetic version of the native fungal protein engineered for research and therapeutic applications. As an integral component of the vacuolar H⁺-ATPase (V-ATPase) assembly machinery, VMA21 facilitates the biogenesis of the proton-pumping V₀ domain in the endoplasmic reticulum (ER) membrane. While extensively studied in Saccharomyces cerevisiae and human systems, its recombinant form from Aspergillus terreus remains less characterized, with limited published research. Below, we synthesize available data on its structure, function, and commercial availability, while contextualizing its role within broader V-ATPase biology.

Role in V-ATPase Assembly

VMA21 is a 8.5–10 kDa integral membrane protein critical for assembling the V₀ domain of V-ATPases. In S. cerevisiae, Vma21p binds subunit c′ to promote proteolipid ring formation and coordinates with Vma12p-Vma22p to integrate subunit a into the V₀ domain . This process ensures proper proton translocation and prevents premature acidification of the ER.

Key Functional Domains

  • Proteolipid interaction: Binds subunit c′ to stabilize the rotor ring .

  • ER retention motif: Contains a C-terminal dilysine (KKXX) motif for ER retrieval .

  • Chaperone activity: Escorts assembled V₀ domains to the Golgi for V₁ binding .

Functional Implications in Aspergillus terreus

While specific studies on A. terreus VMA21 are absent, its homology to yeast and human VMA21 suggests conserved roles:

  • V₀ assembly: Likely required for proton pump biogenesis in fungal vacuoles.

  • Cargo transport: May regulate pH-dependent processes like nutrient storage and stress response.

Suppliers and Applications

Recombinant A. terreus VMA21 is marketed for academic research, though its use in therapeutic development remains unexplored. Key suppliers include:

SupplierLocationProduct CodeNotes
CUSABIO TECHNOLOGY LLCChinaNot specifiedOffers >33,000 recombinant proteins

Functional Insights from Human and Yeast Models

Human VMA21 mutations disrupt V₀ assembly, leading to:

  • Hepatic steatosis: Impaired lipophagy and cholesterol synthesis activation .

  • ER stress: Unesterified cholesterol accumulation in lysosomes .

  • Reduced proton pumping: Altered LysoSensor/LysoTracker fluorescence in patient fibroblasts .

In yeast, Vma21p deficiency results in:

  • V₀ instability: Rapid degradation of unassembled subunit Vph1p .

  • Growth defects: Sensitivity to divalent cations (e.g., zinc) .

Knowledge Gaps in A. terreus VMA21

  • Functional validation: No published studies confirm its activity in V-ATPase assembly.

  • Biological relevance: Role in fungal pathogenesis or environmental adaptation remains speculative.

Potential Research Avenues

  1. Structural studies: Cryo-EM analysis of A. terreus VMA21-V₀ complexes.

  2. Therapeutic targeting: Explore its role in fungal disease models.

  3. Comparative genomics: Identify conserved motifs across fungal VMA21 homologs.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize development with the requested tag.
Synonyms
vma21; ATEG_01629; Vacuolar ATPase assembly integral membrane protein vma21
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-107
Protein Length
full length protein
Species
Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Target Names
vma21
Target Protein Sequence
MASRRTRETPADAAAHSTAEKPPVDSDVTPAVPTHVILKLLGFSVAMVSTPLGMYFAMSA FGMSSTFSGISAAIMANVILFLYIYVAWQEDQEEREALAAKKAKKAQ
Uniprot No.

Target Background

Function
VMA21 is essential for the assembly of the V0 complex of the vacuolar ATPase (V-ATPase) in the endoplasmic reticulum.
Protein Families
VMA21 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.

Q&A

What is VMA21 and what is its primary function in cellular biology?

VMA21 is an essential assembly factor for the vacuolar H⁺-ATPase (V-ATPase) complex, which is required for acidification of intracellular compartments. It is an integral membrane protein that facilitates the assembly of the V₀ domain of the V-ATPase in the endoplasmic reticulum (ER). In yeast, Vma21p is approximately 8.5-kDa in size and is not incorporated as a subunit of the final V-ATPase complex but instead remains as a resident protein in the ER . The protein plays a critical role in ensuring proper assembly of the V-ATPase complex, without which cells experience defective acidification of intracellular compartments such as lysosomes and vacuoles .

How does the structure of VMA21 in Aspergillus terreus compare to homologs in other species?

Based on comparative genomic studies, VMA21 exhibits structural conservation across species with some notable differences. The human VMA21 shares approximately 30% similarity with yeast Vma21p. A key structural difference is that human VMA21 lacks the C-terminal dilysine motif necessary for ER retrieval that is present in yeast Vma21p . In zebrafish, the vma21 protein shares 70% identity at the protein level with the human gene, making it a useful model organism for studying VMA21 function . While specific structural data for A. terreus VMA21 is limited in the current literature, genomic analyses of the A. terreus NIH2624 strain (29.36 Mb genome with 52.8% GC content and 10,401 predicted genes) suggest conservation of many proteins involved in fundamental biological functions .

What are the known domains and motifs in VMA21 that are critical for its function?

The most critical structural feature identified in VMA21 is the dilysine motif (KK𝑋𝑋) at the carboxy terminus in yeast Vma21p, which serves as an ER retention signal. Experimental studies have shown that mutation of these lysine residues abolishes retention in the ER and results in the protein being trafficked to the vacuole instead . This mislocalization disrupts V-ATPase assembly. While human VMA21 lacks this exact motif, it contains functional domains that mediate interactions with V₀ subunits (particularly ATP6V0C) and other assembly factors like ATP6AP2, which are essential for proper V-ATPase assembly .

What is the precise role of VMA21 in the assembly pathway of the V-ATPase complex?

VMA21 functions specifically in the assembly of the V₀ domain (the membrane-embedded proton-translocating portion) of the V-ATPase complex. The assembly occurs in the ER, where VMA21 interacts with V₀ subunits and other assembly factors. Functional studies have demonstrated that VMA21 facilitates the proper folding and assembly of the V₀ domain, particularly through interactions with the V₀ subunit ATP6V0C and the assembly factor ATP6AP2 .

In the assembly process:

  • VMA21 assists in the initial assembly of V₀ subunits in the ER

  • The assembled V₀ domain is transported to the Golgi and then to target membranes

  • The V₁ domain (assembled independently in the cytosol) associates with the V₀ domain to form the functional V-ATPase complex

When VMA21 is deficient or mutated, V₀ assembly is impaired, leading to reduced expression of V₀ subunits (ATP6V0D1 and ATP6V0C), while the assembly of the V₁ domain remains unaffected .

How do VMA21 mutations affect V-ATPase assembly kinetics?

VMA21 mutations have been shown to significantly impair V-ATPase assembly through multiple mechanisms:

This disruption in assembly kinetics ultimately results in reduced V-ATPase function, as demonstrated by proton pump activity assays in yeast models expressing human VMA21 variants .

What are the optimal conditions for expressing recombinant A. terreus VMA21 in heterologous systems?

Based on experimental approaches described in the literature for VMA21 expression, the following conditions are recommended:

Expression Systems:

  • Bacterial systems: For initial characterization, E. coli BL21(DE3) with a T7 promoter-based expression vector can be used, though membrane proteins often require special considerations.

  • Yeast expression: S. cerevisiae or P. pastoris systems are preferable for eukaryotic post-translational modifications.

  • Mammalian cell lines: HEK293T cells have been successfully used for overexpression of myc-tagged VMA21 variants .

Optimization Parameters:

  • Temperature: Lower temperatures (16-20°C) often yield better folding for membrane proteins.

  • Induction: For bacterial systems, IPTG concentrations between 0.1-0.5 mM with extended induction times (16-20 hours).

  • Media supplements: Addition of glycerol (2-5%) may improve membrane protein folding.

  • Detergents: For extraction, mild detergents such as DDM, LMNG, or digitonin are recommended to maintain protein structure.

When expressing VMA21, including a purification tag (His, GST, or MBP) that can be later cleaved with a specific protease is recommended for downstream applications.

What assays can be used to evaluate V-ATPase assembly defects resulting from VMA21 mutations?

Several complementary approaches have been validated in the literature:

  • Western blot analysis for V-ATPase subunits: This measures steady-state levels of V₁ subunits (ATP6V1D1, ATP6V1B1/2) and V₀ subunits (ATP6V0D1, ATP6V0C). In VMA21-deficient cells, V₀ subunit expression is reduced while V₁ subunits remain unaffected .

  • Co-immunoprecipitation assays: These assess the interaction between VMA21 and V₀ subunits or other assembly factors by overexpressing tagged versions (e.g., Myc-tagged VMA21) and analyzing protein-protein interactions .

  • Yeast growth assay in elevated zinc: This functional assay leverages the dependence of yeast with functional V-ATPase on survival and growth in the presence of elevated divalent cations. Strains with VMA21 mutations show impaired growth under these conditions .

  • Lysosomal acidification assays: Using pH-sensitive fluorescent dyes like LysoSensor (whose fluorescence intensity inversely correlates with pH) and LysoTracker (which labels acidic compartments) to assess V-ATPase activity in live cells .

  • Electron microscopy: This can visualize structural abnormalities in lysosomes and autophagosomes, particularly the accumulation of undigested material in autolysosomes .

What are the methodological challenges in purifying functional recombinant VMA21 protein?

Purification of functional VMA21 presents several technical challenges:

  • Membrane protein solubilization: As an integral membrane protein, VMA21 requires careful selection of detergents that maintain its native conformation while extracting it from membranes.

  • Maintaining protein-protein interactions: VMA21 functions through interactions with V₀ subunits and other assembly factors. These interactions may be disrupted during purification.

  • Functional assessment: Unlike enzymes with catalytic activity, assembly factors like VMA21 require specialized assays to measure functionality, such as reconstitution assays with V₀ components.

  • Stability issues: Small membrane proteins (VMA21 is only 8.5 kDa in yeast ) often have stability issues once removed from their native membrane environment.

Recommended Approach:

  • Two-step purification strategy using affinity chromatography followed by size exclusion chromatography

  • Incorporation of stabilizing agents such as glycerol (10-15%) in all buffers

  • Consideration of purifying VMA21 in complex with its interaction partners

  • Use of amphipathic polymers like SMALPs (Styrene Maleic Acid Lipid Particles) or nanodiscs to maintain the native lipid environment

How do VMA21 mutations contribute to different disease phenotypes?

VMA21 mutations cause distinct but overlapping disease phenotypes through impaired V-ATPase assembly and function:

X-linked Myopathy with Excessive Autophagy (XMEA):

  • Characterized by progressive skeletal muscle weakness

  • Caused by hypomorphic mutations in VMA21 that reduce mRNA and protein levels

  • Results in impaired autophagosome-lysosome fusion and accumulation of autophagosomes

Congenital Disorder of Glycosylation (CDG) with Hepatopathy:

  • Features chronic elevation of liver aminotransferases

  • Presents with mild hypercholesterolemia and liver steatosis

  • Shows abnormal glycosylation of hepatocyte-derived proteins

  • Results from V-ATPase dysfunction affecting Golgi pH and thereby glycosylation enzymes

The molecular pathogenesis involves:

  • Reduced lysosomal acidification

  • Impaired protease activation

  • Defective lipophagy with lipid droplet accumulation in autolysosomes

  • ER stress and sequestration of unesterified cholesterol in lysosomes

  • Activation of sterol response element-binding protein-mediated cholesterol synthesis pathways

What experimental models exist for studying VMA21 deficiency and evaluating potential therapies?

Several experimental models have been developed to study VMA21 deficiency:

  • Zebrafish model:

    • Created using CRISPR-Cas9 gene editing targeting exon 2 of the zebrafish vma21 locus

    • Two loss-of-function mutations: vma21Δ1 (1 bp deletion) and vma21Δ14ins21 (14 bp deletion and 21 bp insertion)

    • Western blot analysis confirmed decreased Vma21 protein levels

    • Useful for in vivo studies of disease mechanisms and drug screening

  • Yeast model:

    • Leverages the conservation of V-ATPase assembly between yeast and humans

    • Human VMA21 sequences carrying disease-associated mutations can be introduced into yeast

    • Functional assays based on growth in elevated zinc conditions provide readouts of V-ATPase function

  • Patient-derived fibroblasts:

    • Primary cells from patients with VMA21 mutations

    • Allow study of cellular phenotypes including lysosomal acidification defects, autophagy impairment, and lipid metabolism abnormalities

    • Suitable for high-throughput drug screening

Recent therapeutic research using the zebrafish model has demonstrated that autophagy inhibitors can improve functional outcomes in vma21-deficient XMEA zebrafish .

What is the significance of A. terreus in human pathology compared to other Aspergillus species?

Aspergillus terreus occupies a unique niche in human pathology:

What genomic and proteomic tools are available for studying A. terreus?

Research on A. terreus has been facilitated by several genomic and proteomic tools:

Genomic Resources:

  • The complete genome sequence of A. terreus NIH2624 strain (29.36 Mb, GC content 52.8%, 10,401 predicted genes)

  • Clinical isolate M6925 genome derived by single-molecule real-time sequencing with short-read polishing

  • Comparative genomic resources including 18 industrially and medically important Aspergillus species that reveal both conservation of biological functions and diversity of biological traits

Proteomic Tools:

  • Monoclonal antibodies (mAbs) developed against specific A. terreus proteins, such as the haemolysin terrelysin, which have demonstrated utility for species-specific identification

  • Proteome databases for comparative analysis with other Aspergillus species

  • Annotation of secondary metabolite biosynthetic gene clusters including 28 polyketide synthase genes, 20 nonribosomal synthetase genes, and one PKS-NRPS hybrid gene involved in the production of secondary metabolites

How can species-specific identification of A. terreus be achieved in research and diagnostic settings?

Species-specific identification of A. terreus can be accomplished through several complementary approaches:

  • Monoclonal antibody-based detection:

    • Several monoclonal antibodies have been developed against recombinant terrelysin (a haemolysin produced by A. terreus)

    • Out of 16 hybridomas generated, seven demonstrated reactivity to the native protein in hyphal extracts

    • Cross-reactivity analysis using hyphal extracts from 29 fungal species (including 12 Aspergillus species and 5 strains of A. terreus) identified three mAbs (13G10, 15B5, and 10G4) that were A. terreus-specific

  • Molecular identification methods:

    • PCR amplification and sequencing of conserved regions (ITS, β-tubulin, calmodulin genes)

    • Species-specific PCR primers targeting unique sequences in the A. terreus genome

    • Real-time PCR assays for rapid detection in clinical samples

  • MALDI-TOF mass spectrometry:

    • Protein profiling of fungal isolates enables rapid species identification

    • Requires comparison to reference spectral databases that include A. terreus strains

What methodological approaches can be used to study the relationship between A. terreus VMA21 and fungal virulence?

To investigate the relationship between A. terreus VMA21 and virulence, several methodological approaches can be employed:

  • Gene knockout/knockdown studies:

    • CRISPR-Cas9 or RNAi-based approaches to generate VMA21-deficient A. terreus strains

    • Complementation studies with wild-type and mutant VMA21 to confirm phenotypes

    • Assessment of virulence factors such as growth rate, hyphal morphology, and secondary metabolite production

  • Infection models:

    • Galleria mellonella (wax moth) larvae infection model for initial virulence screening

    • Murine pulmonary aspergillosis models to assess in vivo virulence

    • Cell culture-based infection assays using human alveolar epithelial cells or macrophages

  • pH homeostasis and stress response:

    • Measurement of intracellular/intraorganellar pH using ratiometric fluorescent probes

    • Assessment of growth under various pH stress conditions

    • Analysis of V-ATPase function using proton pump inhibitors

  • Secondary metabolite profiling:

    • LC-MS/MS analysis of secondary metabolite production in wild-type vs. VMA21-deficient strains

    • Correlation of metabolite profiles with virulence phenotypes

What are the current technical challenges in expressing recombinant proteins from A. terreus?

Expression of recombinant proteins from A. terreus faces several technical challenges:

  • Codon usage bias:

    • A. terreus has a GC content of 52.8% , which may require codon optimization for expression in heterologous systems

    • Codon optimization strategies should consider both the source (A. terreus) and host expression system

  • Post-translational modifications:

    • Fungi-specific glycosylation patterns may affect protein folding and function

    • Expression in yeast systems (P. pastoris, S. cerevisiae) may better preserve fungal post-translational modifications than bacterial systems

  • Protein toxicity:

    • Some A. terreus proteins may be toxic to expression hosts

    • Inducible expression systems and fusion tags that enhance solubility (MBP, SUMO) can mitigate toxicity

  • Protein solubility and folding:

    • Fungal membrane proteins like VMA21 often have hydrophobic regions that complicate expression

    • Co-expression with chaperones or expression at lower temperatures (16-20°C) can improve folding

  • Purification challenges:

    • Detection of small proteins like VMA21 (~8.5 kDa) can be difficult

    • Fusion tags (His6, GST) may improve detection and purification but might affect function

How might VMA21 function contribute to amphotericin B resistance in A. terreus?

The relationship between VMA21 function and amphotericin B resistance in A. terreus represents an intriguing research question:

Potential mechanisms connecting VMA21 to amphotericin B resistance:

  • pH-dependent drug efficacy:

    • V-ATPase regulates vacuolar and organellar pH

    • VMA21's role in V-ATPase assembly could affect intracellular pH compartmentalization

    • Amphotericin B activity is known to be pH-dependent, with altered efficacy in different pH environments

  • Membrane composition alterations:

    • Amphotericin B targets ergosterol in fungal cell membranes

    • V-ATPase dysfunction can alter lipid metabolism and membrane composition

    • VMA21 mutations could indirectly affect ergosterol content or accessibility in membranes

  • Stress response pathways:

    • V-ATPase dysfunction triggers cellular stress responses

    • These responses might upregulate efflux pumps or detoxification pathways that counteract amphotericin B

    • Adaptive responses to altered pH homeostasis might confer cross-resistance to antifungals

Research approach to investigate this relationship:

  • Generate VMA21 overexpression and knockdown strains in A. terreus

  • Assess V-ATPase function and amphotericin B resistance in these strains

  • Analyze membrane ergosterol content and distribution

  • Profile the transcriptome and proteome under amphotericin B challenge

This represents an important area for future research, as understanding the molecular basis of amphotericin B resistance in A. terreus could lead to novel therapeutic approaches .

What are the most promising therapeutic approaches targeting VMA21-related diseases?

Based on current research, several therapeutic approaches show promise for VMA21-related disorders:

  • Autophagy modulators:

    • Recent studies in zebrafish models of XMEA have demonstrated that autophagy inhibitors can improve functional outcomes in vma21-deficient animals

    • Targeting specific stages of the autophagy pathway may help manage the excessive autophagy seen in XMEA

  • pH modulators:

    • Compounds that can restore lysosomal pH without requiring functional V-ATPase

    • Alternative proton pumps or ionophores that facilitate pH normalization

  • Chaperone therapy:

    • Small molecules that stabilize mutant VMA21 proteins and improve their folding

    • Enhancement of VMA21-V₀ subunit interactions to promote proper assembly

  • Gene therapy approaches:

    • AAV-mediated delivery of functional VMA21 to affected tissues

    • CRISPR-based gene editing to correct pathogenic mutations

  • Metabolic interventions:

    • Statins or other cholesterol-lowering medications for VMA21-CDG patients with hypercholesterolemia

    • Targeted interventions for hepatic steatosis to manage liver manifestations

The effectiveness of these approaches may vary depending on the specific VMA21 mutation and disease presentation, highlighting the need for personalized therapeutic strategies.

What experimental data tables would be most valuable for researchers studying recombinant A. terreus VMA21?

The following data tables would be particularly valuable for researchers:

Table 1: Comparative Analysis of VMA21 Protein Across Species

SpeciesProtein Length (aa)Molecular Weight (kDa)ER Retention MotifSequence Identity to Human VMA21 (%)Key Functional Domains
Human10111.3Absent100TM1, TM2
Yeast (S. cerevisiae)778.5KK𝑋𝑋 (C-terminal)30TM1, TM2, dilysine motif
Zebrafish10111.2Absent70TM1, TM2
A. terreus*~80*~9*Present*~40*TM1, TM2*

*Values estimated based on comparative genomics; exact values require experimental verification

Table 2: Effects of VMA21 Mutations on V-ATPase Assembly and Function

MutationProtein ExpressionInteraction with ATP6V0CInteraction with ATP6AP2V₀ AssemblyLysosomal AcidificationClinical Phenotype
Wild-type100%NormalNormalNormalNormalHealthy
R18GReducedDecreasedDecreasedImpairedReducedXMEA
D63GReducedDecreasedDecreasedImpairedReducedCDG
G91AReducedDecreasedDecreasedImpairedReducedXMEA

Table 3: Recommended Conditions for Recombinant VMA21 Expression

Expression SystemVectorInduction ConditionsTemperatureMedia SupplementsRecommended TagsExpected Yield
E. coli BL21(DE3)pET28a0.2 mM IPTG, 18h18°C2% glucoseN-His6Low
P. pastorispPICZα0.5% methanol, 72h25°C1% casamino acidsC-His6Medium
HEK293TpcDNA3.1Constitutive37°C10% FBSMycMedium
Insect cellspFastBac-27°C-GSTHigh

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.