Recombinant Aster yellows witches'-broom phytoplasma Ribonuclease Y (rny)

Shipped with Ice Packs
In Stock

Description

General Information

AYWB Phytoplasma: 'Candidatus Phytoplasma asteris' is a plant pathogen that causes various diseases in numerous crops, leading to substantial agricultural losses . The New Jersey aster yellows (NJAY) strain of 'Candidatus Phytoplasma asteris' causes severe lettuce yellows in New Jersey .
Witches' Broom Symptom: This symptom includes extensive branching and shortened internodes, leading to a stunted phenotype of branched shoots .
Ribonuclease Y (rny): RNase Y is a ribonuclease enzyme. The recombinant form is produced using genetic engineering techniques .

Molecular and Biochemical Characteristics

CharacteristicDescription
Product TypeRecombinant Protein
Source SpeciesAster yellows witches'-broom phytoplasma (strain AYWB)
UniProt AccessionQ2NJ28
Tag InformationDetermined during production
Storage BufferTris-based buffer with 50% glycerol
Storage ConditionStore at -20℃; for extended storage, conserve at -20℃ or -80℃. Avoid repeated freezing and thawing. Store working aliquots at 4℃ for up to one week .
Amino Acid SequenceMKDASWRDHCTMGCSLFFLALICGSIIGYFLYSFFNQKKLEEKKQAFDNKLKEKEKDLQKREQEMMRNAKIEIASLRQKLELDLEQRTNTIVDLESKNNRREELLNNRTESLNKREEHLDSEKQIISHTKKNLEQQIKEQETILNTQKQQLEKIASLTQDQARQIIMKETRDQTTYEMMSYIKQEEEKAKSEASKKAKTLLVLAMQKYSGDITGEKNISVVNIPNEDMKGRIIGRQGRNIKSLEVLTGVDLIIDESPCTVILSSFDPIRREIAKKTLEFLVSDGRIHPSRIEKALETSTIEVDNFIKEMGEEATFITKIGEVHPDLIKILGKLHFRISYSQNVLKHSLEVAFLAGKLASEIGENEILARRAGLFHDIGKALDHEMEGSHVEIGVSIASKYKEKKEVIDAIASHHEDQEPQSIIAALVAIADTLSSARPGARKESVENYIQRLTKLETIANSTKGVAKSYAIQAGREIRVIVEPDKIADNFIFQTARTIKEQIEKEIIYNGVIKVTVLRETRAVEMAKL
Protein NamesRibonuclease Y (RNase Y)
Gene Namesrny; Ordered Locus Names: AYWB_448
Expression Region1-528 amino acids

Role in Phytoplasma Pathogenesis

Phytoplasmas secrete effector proteins that manipulate host cellular processes by reprogramming their transcriptome, which facilitates colonization and insect transmission . For instance, the effector SJP39 in jujube Witches’ Broom (JWB) phytoplasma interacts with the plant transcription factor bHLH87, leading to growth defects .

Research and Detection

  • Small RNA Profiling: Small RNA sequencing has been used to study 'Candidatus Phytoplasma asteris' infections in Catharanthus roseus, revealing virescence and witches' broom symptoms .

  • Genome Sequencing: Draft genome sequences of phytoplasmas like the NJAY strain have been prepared and analyzed, showing approximately 0.5% dissimilarity at the nucleotide level compared to the AY-WB strain among shared genomic segments .

  • Comparative Genomics: Comparative analyses of enzymatic capacities in different phytoplasma strains (NJAY, AY-WB, and OY-M) have been conducted to understand their metabolic distinctiveness .

  • PCR/RFLP Analysis: PCR and restriction fragment length polymorphism (RFLP) analysis are employed to detect and differentiate phytoplasmas, including Aster Yellows strains .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To prioritize a specific tag, please inform us during your order.
Synonyms
rny; AYWB_448; Ribonuclease Y; RNase Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-528
Protein Length
full length protein
Species
Aster yellows witches'-broom phytoplasma (strain AYWB)
Target Names
rny
Target Protein Sequence
MKDASWRDHCTMGCSLFFLALICGSIIGYFLYSFFNQKKLEEKKQAFDNKLKEKEKDLQK REQEMMRNAKIEIASLRQKLELDLEQRTNTIVDLESKNNRREELLNNRTESLNKREEHLD SEKQIISHTKKNLEQQIKEQETILNTQKQQLEKIASLTQDQARQIIMKETRDQTTYEMMS YIKQEEEKAKSEASKKAKTLLVLAMQKYSGDITGEKNISVVNIPNEDMKGRIIGRQGRNI KSLEVLTGVDLIIDESPCTVILSSFDPIRREIAKKTLEFLVSDGRIHPSRIEKALETSTI EVDNFIKEMGEEATFITKIGEVHPDLIKILGKLHFRISYSQNVLKHSLEVAFLAGKLASE IGENEILARRAGLFHDIGKALDHEMEGSHVEIGVSIASKYKEKKEVIDAIASHHEDQEPQ SIIAALVAIADTLSSARPGARKESVENYIQRLTKLETIANSTKGVAKSYAIQAGREIRVI VEPDKIADNFIFQTARTIKEQIEKEIIYNGVIKVTVLRETRAVEMAKL
Uniprot No.

Target Background

Function
Endoribonuclease initiating mRNA decay.
Database Links
Protein Families
RNase Y family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Aster yellows witches'-broom phytoplasma and how does it cause disease in plants?

Aster yellows witches'-broom phytoplasma is a phloem-limited, cell wall-less bacterial pathogen (phytoplasma) that causes significant damage to plants. It belongs to a class of microorganisms intermediate between bacteria and viruses that parasitize plant phloem tissue . AY-WB phytoplasma infection results in a characteristic "witches' broom" appearance in infected plants, marked by abnormal growth patterns including:

  • Formation of massed, brush-like development of numerous weak shoots

  • Stunted growth with chlorotic (yellowing) foliage

  • Deformed flower parts with curious abnormalities

  • Reversion of flower parts back to leaf forms (particularly in plants like echinacea)

  • Spindly upright leaves

The disease affects over 200 species of plants across more than 40 plant families worldwide, with particular susceptibility observed in aster, echinacea, gaillardia, rudbeckia, scabiosa, and veronica . The pathogen is transmitted primarily by insect vectors, particularly leafhoppers, planthoppers, and psyllids, which acquire the phytoplasma when feeding on infected plants and subsequently transmit it to healthy plants .

What is the molecular structure and function of Ribonuclease Y in bacterial systems?

Ribonuclease Y (RNase Y) is an essential endoribonuclease involved in the initiation of RNA degradation in many bacterial systems. In Bacillus subtilis, where it has been extensively studied, RNase Y plays a pivotal role in mRNA processing and degradation . The enzyme typically consists of multiple domains with specific functions:

  • A transmembrane domain that anchors the protein to the cell membrane

  • A coiled-coil domain involved in protein-protein interactions

  • A KH domain for RNA binding

  • A HD domain with catalytic activity for RNA cleavage

RNase Y functions as part of an RNA degradosome-like complex, interacting with other ribonucleases (RNases), RNA helicases, and sometimes metabolic enzymes such as enolase and phosphofructokinase . In B. subtilis, RNase Y exhibits a natively disordered structure in certain domains, which facilitates its interactions with multiple protein partners.

While direct information on AY-WB phytoplasma RNase Y is limited in the literature, comparative genomic analyses suggest that this enzyme likely fulfills similar RNA processing functions in phytoplasmas, contributing to their adaptation to different host environments and potentially to their pathogenicity.

Why has recombinant expression of AY-WB phytoplasma RNase Y become important in phytoplasma research?

Recombinant expression of AY-WB phytoplasma RNase Y has emerged as a crucial research avenue for several reasons:

  • Cultivation limitations: Phytoplasmas cannot be cultured in cell-free media, making direct study of their proteins extremely challenging. Recombinant expression provides a viable alternative for obtaining sufficient quantities of phytoplasmal proteins for research.

  • Functional characterization: Understanding RNase Y function may provide insights into phytoplasma gene regulation and host adaptation mechanisms, as RNA processing is particularly important in organisms with reduced genomes like phytoplasmas.

  • Comparative studies: Phytoplasma genomes contain unique mobile genetic elements called Potential Mobile Units (PMUs) , and RNase Y may play a role in regulating the expression of genes within these elements.

  • Therapeutic targets: As an essential enzyme, RNase Y represents a potential target for developing strategies to control phytoplasma diseases, which currently have no effective treatments.

  • Evolution of RNA degradation systems: Studying phytoplasma RNase Y contributes to our understanding of the evolution of RNA degradation systems in diverse bacterial lineages, particularly in obligate parasites with reduced genomes.

What are the recommended protocols for cloning and expressing recombinant AY-WB phytoplasma RNase Y?

Based on successful approaches for other phytoplasma proteins, the following protocol is recommended for cloning and expressing recombinant AY-WB phytoplasma RNase Y:

DNA Template Preparation:

  • Isolate total DNA from AY-WB phytoplasma-infected plant tissue using established phytoplasma DNA extraction protocols .

  • Verify the presence of phytoplasma DNA using diagnostic PCR targeting the 16S rRNA gene.

Gene Amplification and Cloning:

  • Design degenerate PCR primers based on conserved regions of RNase Y genes from related organisms .

  • Use booster PCR technique to amplify the rny gene from total DNA preparations of infected plants.

  • Clone the amplified product into a suitable vector (e.g., pCR2.1) for sequence verification .

  • Once verified, subclone the gene into an expression vector (e.g., pET28a) with an appropriate tag (His6 or GST) for purification.

Expression Optimization:

  • Transform the recombinant expression vector into E. coli BL21(DE3) or Rosetta(DE3) strains.

  • Test expression at different temperatures (16°C, 25°C, and 37°C) and IPTG concentrations (0.1-1.0 mM).

  • For membrane-associated proteins like RNase Y, expression with the transmembrane domain deleted often improves solubility .

  • Consider expressing the protein as separate domains if full-length expression proves difficult.

Expression Conditions Table:

ParameterOptimization RangeRecommended Condition
Expression hostBL21(DE3), Rosetta(DE3), Arctic ExpressRosetta(DE3) for rare codon usage
Growth temperature16°C, 25°C, 37°C16°C for 18-24 hours post-induction
IPTG concentration0.1 mM, 0.5 mM, 1.0 mM0.1 mM for slow, controlled expression
MediaLB, TB, 2xYT, M9TB for higher cell density and protein yield
Construct designFull-length, ΔTM domainΔTM domain for improved solubility
Fusion tagsHis6, GST, MBP, SUMOMBP or SUMO for enhanced solubility

What purification strategies yield the highest purity and activity for recombinant AY-WB phytoplasma RNase Y?

Purification of recombinant AY-WB phytoplasma RNase Y requires careful optimization to maintain protein activity while achieving high purity. The following multi-step purification strategy is recommended:

Initial Capture:

  • For His-tagged constructs, use immobilized metal affinity chromatography (IMAC) with Ni-NTA resin.

  • For GST-tagged constructs, use glutathione sepharose affinity chromatography.

  • Include protease inhibitors (e.g., PMSF, EDTA-free protease inhibitor cocktail) in all buffers to prevent degradation.

Intermediate Purification:

  • Following affinity purification, perform ion exchange chromatography (IEX) using either anion (Q-Sepharose) or cation (SP-Sepharose) exchangers depending on the protein's isoelectric point.

  • Consider adding a stabilizing agent such as glycerol (10-20%) to all buffers.

Polishing Step:

  • Size exclusion chromatography (SEC) on Superdex 200 or similar matrix to separate monomeric protein from aggregates and other impurities.

  • For functional studies, confirm that the purified protein maintains ribonuclease activity using standard RNase assays.

Critical Considerations:

  • Due to potential membrane association, include detergents (0.1% Triton X-100 or 0.05% DDM) in initial extraction buffers.

  • Test stability in different buffer systems (Tris, HEPES, phosphate) at various pH values (6.5-8.0).

  • Add reducing agents (1-5 mM DTT or 2-10 mM β-mercaptoethanol) to prevent oxidation of cysteine residues.

Post-Purification Analysis:

  • Verify purity by SDS-PAGE (>95% purity recommended for functional studies).

  • Confirm identity by Western blotting and/or mass spectrometry.

  • Check for proper folding using circular dichroism spectroscopy.

What methods are most effective for assessing the ribonuclease activity of purified recombinant AY-WB phytoplasma RNase Y?

Several complementary approaches can be used to comprehensively assess the ribonuclease activity of purified recombinant AY-WB phytoplasma RNase Y:

Fluorescence-Based Assays:

  • Use RNaseAlert® substrate or similar fluorescent resonance energy transfer (FRET)-based substrates that emit fluorescence upon cleavage.

  • Monitor fluorescence increase over time using a microplate reader to determine initial reaction rates at different enzyme concentrations.

  • Determine kinetic parameters (Km, kcat) by varying substrate concentrations.

Gel-Based RNA Degradation Assays:

  • Incubate the purified enzyme with various RNA substrates (total RNA, synthetic RNA oligonucleotides, or specific mRNA targets).

  • Analyze the degradation products using denaturing polyacrylamide gel electrophoresis.

  • Perform time-course experiments to monitor the progression of RNA cleavage.

Substrate Specificity Determination:

  • Test activity against different RNA structures (single-stranded, stem-loops, bulges) to determine structural preferences.

  • Examine sequence specificity using synthetic RNA oligonucleotides with different sequences.

  • Compare activity on 5'-monophosphorylated versus 5'-triphosphorylated substrates.

Activity Modulation Analysis:

  • Test the effects of divalent cations (Mg²⁺, Mn²⁺, Ca²⁺) on enzyme activity.

  • Evaluate pH dependence (pH range 5.5-9.0) to determine the optimal conditions.

  • Assess the impact of potential protein partners (identified through co-immunoprecipitation studies) on enzyme activity.

Data Analysis and Reporting:

  • Report specific activity as units of enzyme activity per mg protein.

  • Present kinetic parameters with appropriate statistical analysis.

  • Compare results with those of RNase Y from other bacterial systems for context.

How does the predicted domain structure of AY-WB phytoplasma RNase Y compare to RNase Y in other bacterial systems?

While specific structural data on AY-WB phytoplasma RNase Y is limited, comparative bioinformatic analysis provides insights into its likely domain organization compared to better-characterized bacterial RNase Y proteins:

Predicted Domain Organization of AY-WB Phytoplasma RNase Y:

DomainApproximate PositionPredicted FunctionConservation Level
N-terminal TM domain1-25 aaMembrane anchoringModerately conserved
Coiled-coil domain30-90 aaProtein-protein interactionsHighly variable
KH domain100-180 aaRNA bindingConserved
HD domain200-320 aaCatalytic activityHighly conserved
C-terminal region320-400 aaUnknown (possible regulatory)Poorly conserved

Key Differences from B. subtilis RNase Y:

  • The AY-WB phytoplasma RNase Y likely contains fewer intrinsically disordered regions compared to B. subtilis RNase Y, which is described as a natively disordered protein .

  • The phytoplasma enzyme may have a simpler domain organization, reflecting the reduced genomic complexity of phytoplasmas.

  • Sequence analysis suggests potential adaptations to the unique phytoplasma lifestyle, including potential interactions with phytoplasma-specific proteins.

Functional Implications:

  • The conserved HD catalytic domain suggests similar enzymatic mechanism despite evolutionary divergence.

  • Variations in the coiled-coil domain may reflect different protein interaction networks compared to other bacterial systems.

  • The transmembrane domain, if present, indicates similar membrane localization as in other bacteria, which may be important for co-localization with other RNA degradation machinery components.

What protein-protein interactions have been identified or predicted for AY-WB phytoplasma RNase Y?

Current research suggests several potential protein interaction partners for AY-WB phytoplasma RNase Y, based on known interactions in other bacterial systems and preliminary phytoplasma-specific data:

Predicted Core Degradosome Components:

  • RNA helicase: Likely interaction with phytoplasma CshA-like helicase to unwind structured RNA substrates.

  • Phospholipase D: Potential interaction based on conservation of this interaction in other Gram-positive bacteria.

  • Polynucleotide phosphorylase (PNPase): Likely involved in processive degradation of RNA fragments generated by RNase Y.

Phytoplasma-Specific Interactions:

  • Immunodominant membrane protein (IMP): Preliminary data suggests IMP may interact with various phytoplasma proteins including RNases . This interaction could potentially link RNA processing to the membrane proteome.

  • Phytoplasmal effector causing phyllody 1 (PHYL1): PHYL1 has been shown to interact with multiple phytoplasmal proteins , and may potentially modulate RNase Y activity during host infection.

Interaction Detection Methods:

  • Co-immunoprecipitation with anti-RNase Y antibodies followed by mass spectrometry represents the most direct approach to identifying interaction partners.

  • Bacterial two-hybrid or yeast two-hybrid screens can be used with RNase Y domains as bait to identify specific interactions.

  • Crosslinking studies followed by tandem mass spectrometry (XL-MS) can help identify transient interactions.

Functional Significance:

  • Interactions with other ribonucleases and RNA-binding proteins would suggest the formation of a degradosome-like complex in phytoplasmas, similar to that observed in B. subtilis .

  • Interaction with phytoplasma-specific proteins might indicate unique adaptations of the RNA degradation machinery to the phytoplasma lifestyle and pathogenicity mechanisms.

How do sequence variations in RNase Y correlate with functional differences between phytoplasma strains?

Sequence analysis of RNase Y across different phytoplasma strains reveals interesting correlations with strain-specific phenotypes and host interactions:

Key Sequence Variation Patterns:

  • Catalytic HD domain: Generally highly conserved across strains, with occasional amino acid substitutions that might fine-tune activity.

  • KH RNA-binding domain: Shows moderate variability, potentially reflecting adaptation to different RNA targets in various hosts.

  • N-terminal region: Exhibits the highest variability, suggesting strain-specific protein interactions or regulatory mechanisms.

Sequence-Function Correlation Analysis:

  • Phytoplasma strains causing more severe symptoms often show specific amino acid substitutions in the regulatory domains of RNase Y.

  • Correlation between RNase Y sequence clusters and host range specificity suggests potential adaptation of RNA processing to different plant hosts.

  • Variations in potential phosphorylation sites may indicate different regulatory mechanisms across phytoplasma lineages.

Methodology for Comparative Analysis:

  • Multiple sequence alignment of RNase Y sequences from different phytoplasma strains.

  • Phylogenetic analysis to identify evolutionary relationships.

  • Mapping of sequence variations onto predicted structural models.

  • Correlation of specific sequence features with strain phenotypes and host ranges.

Experimental Validation Approaches:

  • Site-directed mutagenesis of specific residues identified in comparative analysis.

  • Heterologous expression of RNase Y variants from different phytoplasma strains.

  • In vitro activity assays comparing enzyme parameters across variants.

  • Complementation studies in model bacterial systems lacking endogenous RNase Y.

What are the current technical challenges in studying AY-WB phytoplasma RNase Y and how can they be overcome?

Researchers face several significant challenges when studying AY-WB phytoplasma RNase Y, but innovative approaches can help overcome these limitations:

Major Technical Challenges:

  • Uncultivability of phytoplasmas: Unable to grow phytoplasmas in artificial media, making native protein isolation impossible.

    • Solution: Leverage recombinant expression systems with codon optimization for heterologous hosts, and develop improved plant-based expression systems.

  • Membrane association: The transmembrane domain of RNase Y creates solubility and purification challenges.

    • Solution: Design truncated constructs lacking the transmembrane domain, use detergent screening, and explore membrane mimetic systems (nanodiscs, amphipols).

  • Complex formation: RNase Y likely functions in a multi-protein complex, making functional studies of the isolated protein potentially misleading.

    • Solution: Co-expression with predicted interaction partners, develop reconstitution protocols for minimal functional complexes.

  • In vivo validation: Limited genetic tools for phytoplasmas make functional validation challenging.

    • Solution: Develop surrogate systems using related bacteria amenable to genetic manipulation, or explore heterologous complementation approaches.

  • Structural characterization: Obtaining structural information about phytoplasma proteins is challenging.

    • Solution: Employ cryo-electron microscopy for complex structures, use NMR for domain-specific studies, and leverage computational structure prediction tools like AlphaFold2.

Emerging Methodological Approaches:

  • Single-cell techniques for studying phytoplasma-infected plant cells.

  • Nanobody development for specific detection and potentially inhibition.

  • Droplet microfluidics for high-throughput screening of optimal buffer conditions.

How can advanced structural biology techniques be applied to elucidate the mechanism of AY-WB phytoplasma RNase Y?

Modern structural biology offers powerful approaches to understand the molecular mechanism of AY-WB phytoplasma RNase Y despite the challenges inherent to this system:

Cryo-Electron Microscopy (Cryo-EM):

  • Single-particle cryo-EM can potentially resolve the structure of full-length RNase Y or its complexes with interacting partners.

  • Sample preparation strategies including detergent solubilization, amphipols, or nanodiscs can be employed for membrane-associated domains.

  • Time-resolved cryo-EM could potentially capture different conformational states during the catalytic cycle.

X-ray Crystallography:

  • Focus on individual domains (especially the catalytic HD domain) rather than the full-length protein.

  • Use surface entropy reduction and fusion protein approaches to enhance crystallizability.

  • Co-crystallization with substrate analogs or inhibitors to capture functionally relevant states.

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Particularly valuable for studying the dynamics of RNA binding domains.

  • Can provide residue-level information on protein-RNA interactions.

  • Suitable for investigating intrinsically disordered regions that may be present.

Integrative Structural Biology Approaches:

  • Combine low-resolution techniques (small-angle X-ray scattering, SAXS) with high-resolution domain structures.

  • Use hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes and interaction surfaces.

  • Apply computational modeling and molecular dynamics simulations to integrate diverse experimental data.

Protein-Protein Docking Analysis:

  • Similar to approaches used for IMP and other phytoplasma proteins , computational docking can predict interaction interfaces between RNase Y and its partners.

  • These predictions can then guide mutagenesis experiments to validate functional interactions.

What role might RNase Y play in the adaptation of AY-WB phytoplasma to different host environments?

RNase Y likely plays a critical role in the adaptation of AY-WB phytoplasma to different host environments through several potential mechanisms:

Transcriptome Remodeling:

  • Differential RNA processing may allow rapid adaptation to distinct plant and insect host environments.

  • RNase Y could selectively degrade certain transcripts while preserving others, effectively reprogramming the phytoplasma transcriptome.

  • This mechanism might be particularly important for phytoplasmas, which have limited transcriptional regulatory capacity due to reduced genomes.

Potential Mobile Unit (PMU) Regulation:

  • Phytoplasma genomes contain unique mobile genetic elements called PMUs that exist in both chromosomal and extrachromosomal forms .

  • RNase Y may regulate the expression of genes within these PMUs, potentially controlling their mobilization and contributing to genomic plasticity.

  • The differential abundance of PMUs between plant and insect hosts suggests regulated expression that might involve RNase Y.

Host-Pathogen Interface:

  • RNase Y could process transcripts encoding effector proteins that interact with host machinery.

  • Temporal control of effector production through RNA processing might be a key aspect of the infection cycle.

  • Post-transcriptional regulation via RNase Y may fine-tune virulence factor expression in response to host signals.

Experimental Approaches to Test These Hypotheses:

  • RNA-seq analysis comparing transcriptomes of phytoplasma in different hosts or tissues.

  • Identification of RNase Y cleavage sites using RNA degradome sequencing.

  • In vitro reconstitution of RNase Y-dependent RNA processing using synthetic transcripts.

  • Comparative analysis of closely related phytoplasma strains with different host ranges or virulence characteristics.

What bioinformatic tools are most appropriate for analyzing the evolutionary history of phytoplasma RNase Y?

Several specialized bioinformatic approaches are particularly valuable for investigating the evolutionary history of phytoplasma RNase Y:

Sequence-Based Evolutionary Analysis:

  • MEGA X or PAML for phylogenetic reconstruction using maximum likelihood methods.

  • RAxML-NG for more complex evolutionary models appropriate for highly divergent sequences.

  • MAFFT and MUSCLE for generating accurate multiple sequence alignments of RNase Y sequences.

  • IQ-TREE for model selection and ultrafast bootstrap analysis to assess confidence in tree topology.

Specialized Evolutionary Analyses:

  • Selecton Server to identify residues under positive or purifying selection.

  • FUBAR and MEME algorithms to detect episodic diversifying selection at individual sites.

  • CODEML analysis to calculate dN/dS ratios across different lineages and detect branch-specific selection.

  • Diverge software to identify type I and type II functional divergence between RNase Y clusters.

Structural Evolution Analysis:

  • ConSurf Server to map sequence conservation onto structural models.

  • FoldX for stability calculations of ancestral mutations.

  • Evolutionary trace methods to correlate sequence variations with functional specificity.

Recommended Analysis Pipeline:

  • Collect RNase Y sequences from diverse phytoplasma strains and related bacteria.

  • Perform domain-specific alignments to account for different evolutionary rates across the protein.

  • Construct phylogenetic trees using appropriate evolutionary models.

  • Perform ancestral sequence reconstruction to infer the evolutionary trajectory.

  • Map key evolutionary events onto the phytoplasma species tree to identify potential host adaptation signatures.

How should researchers interpret apparent contradictions in experimental results when studying AY-WB phytoplasma RNase Y?

Contradictory results are common in research on challenging systems like phytoplasma proteins. The following framework helps researchers systematically analyze and resolve such contradictions:

Common Sources of Contradictions:

  • Expression system artifacts: Different expression systems may produce proteins with varying properties and post-translational modifications.

  • Protein preparation heterogeneity: Variations in purification protocols can lead to different protein conformations or oligomeric states.

  • Assay-specific biases: Different activity assays may emphasize different aspects of enzyme function.

  • Host context effects: Results from in vitro studies may contradict observations in plant or insect hosts.

Systematic Resolution Approach:

  • Methodological cross-validation: Repeat key experiments using multiple independent methods.

  • Multiple expression systems comparison: Express protein in different hosts (E. coli, yeast, insect cells) and compare properties.

  • Domain-based analysis: Test individual domains separately to isolate conflicting behaviors.

  • Contextual dependency investigation: Systematically vary experimental conditions (pH, salt concentration, temperature) to identify conditional behaviors.

Data Integration Framework:

  • Develop a comprehensive model that accommodates apparently contradictory results by identifying the specific conditions under which each observation holds true.

  • Use Bayesian statistical approaches to weigh evidence from different experimental systems.

  • Consider alternative hypotheses such as conditional protein behavior or multiple functional modes.

Reporting Guidelines:

What statistical approaches are most appropriate for analyzing enzyme kinetic data from recombinant AY-WB phytoplasma RNase Y?

Rigorous statistical analysis of enzyme kinetic data is essential for meaningful interpretation of RNase Y activity. The following approaches are recommended:

Model Selection and Parameter Estimation:

  • Non-linear regression analysis using software such as GraphPad Prism, R, or Python with specialized libraries.

  • Akaike Information Criterion (AIC) to compare different kinetic models (Michaelis-Menten, substrate inhibition, allosteric models).

  • Global fitting approaches for analyzing multiple datasets simultaneously with shared parameters.

  • Bootstrapping methods to obtain robust confidence intervals for kinetic parameters.

Dealing with Enzyme-Specific Challenges:

  • Progress curve analysis for slow-binding enzymes or those exhibiting time-dependent behavior.

  • Statistical tests for cooperativity when allosteric behavior is suspected.

  • Robust regression methods to minimize the influence of outliers in difficult-to-measure systems.

Comparison Between Conditions:

  • Extra sum-of-squares F test to determine if datasets differ significantly in specific parameters.

  • Two-way ANOVA to analyze the effects of multiple factors (e.g., pH and temperature) on enzyme activity.

  • Mixed-effects models for analyzing data from multiple protein preparations with random batch effects.

Recommended Reporting Practices:

  • Report all kinetic parameters with appropriate confidence intervals.

  • Present residual plots to demonstrate goodness of fit.

  • Include statistical tests for model discrimination.

  • Provide sufficient raw data, either in supplementary materials or repositories, to allow independent reanalysis.

What are the most common technical issues encountered when expressing recombinant AY-WB phytoplasma RNase Y and how can they be resolved?

Researchers frequently encounter several technical challenges when expressing recombinant AY-WB phytoplasma RNase Y. Here are the most common issues and their recommended solutions:

Poor Expression Yield:

  • Problem: Low or undetectable protein expression levels.

    • Solution: Optimize codon usage for the expression host, reduce expression temperature to 16-18°C, try different promoter systems, or use specialized expression hosts like Rosetta(DE3) strains for rare codon optimization.

  • Problem: Protein toxicity to expression host.

    • Solution: Use tightly controlled inducible systems, reduce inducer concentration, employ host strains with enhanced tolerance to toxic proteins, or express as separate domains.

Protein Insolubility:

  • Problem: Formation of inclusion bodies.

    • Solution: Express as fusion with solubility-enhancing tags (MBP, SUMO, TrxA), co-express with chaperones, reduce expression temperature, or employ in vitro refolding protocols if necessary.

  • Problem: Membrane association leading to insolubility.

    • Solution: Remove transmembrane domain, use detergent screening to identify optimal solubilization conditions, or consider membrane-mimetic systems.

Protein Instability:

  • Problem: Rapid degradation during expression or purification.

    • Solution: Include protease inhibitors, reduce purification time, identify and mutate protease-susceptible sites, or add stabilizing agents (glycerol, arginine, trehalose).

  • Problem: Aggregation during storage.

    • Solution: Optimize buffer conditions (pH, salt concentration), add stabilizing agents, store at appropriate concentration (typically 1-5 mg/mL), or consider flash-freezing small aliquots.

Troubleshooting Decision Tree:

When encountering expression problems, follow this systematic approach:

  • Verify construct design and sequence

  • Test multiple expression conditions in small-scale

  • Analyze solubility in different buffer systems

  • Optimize purification protocol based on initial results

  • Employ stability screening to identify optimal storage conditions

How can researchers develop reliable activity assays for AY-WB phytoplasma RNase Y when working with challenging RNA substrates?

Developing reliable activity assays for RNase Y requires careful consideration of substrate properties, assay conditions, and detection methods:

Substrate Design Considerations:

  • Defined synthetic substrates: Design RNA oligonucleotides with fluorescent labels (5'-FAM, 3'-TAMRA) for FRET-based detection of cleavage.

  • Natural substrate mimics: Generate in vitro transcribed RNAs corresponding to predicted natural targets of RNase Y.

  • Structure-specific substrates: Design RNAs with specific secondary structures (stem-loops, bulges) to assess structural preferences.

Assay Optimization Parameters:

  • Buffer composition: Systematically test different buffers (HEPES, Tris, phosphate) at pH range 6.0-8.0.

  • Divalent cation requirements: Test Mg²⁺, Mn²⁺, Ca²⁺ at concentrations from 1-10 mM.

  • Salt concentration: Optimize KCl or NaCl concentration (typically 50-200 mM).

  • Additives: Evaluate the effects of stabilizing agents (glycerol, BSA) on activity.

Detection Method Selection:

  • Real-time fluorescence assays: For continuous monitoring of reaction kinetics with fluorescent substrates.

  • Gel-based analysis: For complex or structure-specific substrates, with either radioactive or fluorescent labeling.

  • HPLC-based methods: For precise quantification of cleavage products.

  • Mass spectrometry: For definitive identification of cleavage sites.

Controls and Validation:

  • Negative controls: Include catalytically inactive mutants (typically with mutations in the HD domain).

  • Specificity controls: Test activity on DNA substrates or RNase-resistant modified RNAs.

  • Cross-validation: Compare results across different detection methods.

  • Time-course analysis: Monitor reaction progression to ensure measurements are made in the linear range.

What strategies can be employed to study the in vivo function of RNase Y in phytoplasmas given the lack of genetic manipulation tools?

Despite the inability to directly genetically manipulate phytoplasmas, several innovative approaches can provide insights into the in vivo function of RNase Y:

Heterologous Complementation:

  • Express AY-WB phytoplasma RNase Y in rny-deficient B. subtilis strains.

  • Assess the ability of phytoplasma RNase Y to complement the essential functions of B. subtilis RNase Y.

  • Compare RNA degradation patterns between wild-type B. subtilis and strains expressing phytoplasma RNase Y.

Inhibitor-Based Approaches:

  • Develop specific inhibitors against RNase Y using in vitro screening methods.

  • Apply these inhibitors to phytoplasma-infected plant tissues to observe phenotypic effects.

  • Monitor changes in phytoplasma RNA levels and processing patterns following inhibitor treatment.

RNA-Based Analysis:

  • Perform comparative transcriptomics between healthy and phytoplasma-infected plants.

  • Identify transcripts with processing patterns consistent with RNase Y activity.

  • Use degradome sequencing to map RNA cleavage sites in vivo and correlate with RNase Y specificity determined in vitro.

Protein-Protein Interaction Studies:

  • Express tagged versions of RNase Y in phytoplasma-infected plants using plant virus vectors.

  • Perform immunoprecipitation followed by mass spectrometry to identify interaction partners.

  • Validate interactions using bimolecular fluorescence complementation or co-immunoprecipitation approaches.

Temporal and Spatial Analysis:

  • Generate antibodies against RNase Y for immunolocalization studies.

  • Track RNase Y expression and localization during different stages of infection.

  • Correlate RNase Y levels with changes in phytoplasma gene expression and symptom development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.