Recombinant Asterias forbesii NADH-ubiquinone oxidoreductase chain 1 (ND1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, and this can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ND1; NADH-ubiquinone oxidoreductase chain 1; NADH dehydrogenase subunit 1; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Asterias forbesi (Forbes' starfish)
Target Names
ND1
Target Protein Sequence
MLLLFLNSVGFIVPVLLAVALLTLIERKMLGYMHVRKGPNNVGPYGLLQPIADGFKLLIK ETLKPSNASPYLFYSSPALFLFLAILLWSIIPVGESTLNFNLSLVLILGLSSLSVYSLLG SGWSSNS
Uniprot No.

Target Background

Function
A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly required for catalysis. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 1 (ND1) and what organism does it come from?

NADH-ubiquinone oxidoreductase chain 1 (ND1) is a mitochondrial protein that forms part of Complex I in the electron transport chain. In this context, we're discussing the ND1 protein from Asterias forbesii (Forbes' starfish), a common sea star species found along the North American Atlantic coast from the Gulf of Maine to the Gulf of Mexico . This organism inhabits intertidal areas and shallow waters, preferring rocky substrates and bivalve beds . The protein plays a crucial role in the initial steps of mitochondrial electron transport and energy production.

What is the biological function of ND1 in mitochondrial processes?

ND1 is an essential component of NADH:ubiquinone oxidoreductase (Complex I), which serves as the first enzyme in the mitochondrial electron transport chain . This complex contains a flavin mononucleotide (FMN) that oxidizes NADH and eight iron-sulfur clusters that facilitate electron transfer . Seven of these clusters form an electron transfer pathway between the flavin and the quinone-binding site, while one cluster is positioned on the opposite side of the flavin . The ND1 subunit is involved in proton pumping across the inner mitochondrial membrane, contributing to the establishment of the proton gradient necessary for ATP synthesis.

How is recombinant Asterias forbesii ND1 typically expressed and purified?

The recombinant Asterias forbesii ND1 protein is typically expressed in Escherichia coli expression systems . The commercially available form includes an N-terminal His-tag to facilitate purification through affinity chromatography methods . Following expression, the protein undergoes purification protocols that achieve greater than 90% purity as determined by SDS-PAGE analysis . The purified protein is typically provided as a lyophilized powder in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0 .

What are the optimal storage and handling conditions for recombinant ND1?

For optimal stability, the lyophilized ND1 protein should be stored at -20°C to -80°C upon receipt . Aliquoting is necessary when multiple uses are anticipated to avoid repeated freeze-thaw cycles, which can compromise protein integrity . For working solutions, the protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Addition of glycerol to a final concentration of 5-50% is recommended for long-term storage, with 50% being the standard recommendation . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided . Prior to opening, brief centrifugation of the vial is recommended to bring contents to the bottom .

Storage ConditionRecommendation
Long-term storage-20°C to -80°C
Working aliquots4°C (up to one week)
Buffer compositionTris/PBS-based, 6% Trehalose, pH 8.0
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mL
Glycerol addition5-50% final concentration (50% recommended)

What analytical techniques are appropriate for studying ND1 function?

Given the role of ND1 in electron transport, electron paramagnetic resonance (EPR) spectroscopy is a particularly valuable technique for analyzing the iron-sulfur clusters involved in electron transfer . EPR allows researchers to observe the spectra from different clusters within the protein complex and characterize their redox properties. Other appropriate techniques include:

  • SDS-PAGE for purity assessment and molecular weight confirmation

  • Western blotting for specific detection using anti-His antibodies

  • Activity assays measuring NADH oxidation or ubiquinone reduction

  • Protein-protein interaction studies to examine association with other Complex I components

  • Membrane reconstitution experiments to assess proton pumping activity

How do the iron-sulfur clusters in ND1 contribute to electron transfer, and how can they be studied?

The iron-sulfur clusters in Complex I, including those associated with ND1, form an electron transfer pathway essential for mitochondrial function. These clusters can be systematically studied using EPR spectroscopy by analyzing their characteristic spectra at different reduction potentials . Research has shown that Complex I contains both [2Fe-2S] and [4Fe-4S] clusters with distinct spectroscopic signatures labeled as N1a, N1b, N3, N4, and N5 .

For comprehensive analysis, researchers can employ very low potential reductants to impose potentials approaching -1 V, which allows observation of all reducible clusters . By comparing spectra obtained at different potentials and from isolated subcomplexes, scientists can model the complex spectral patterns and identify individual cluster contributions . The N1b spectrum (from a [2Fe-2S] cluster in the 75 kDa subunit) exhibits a lower reduction potential than the N3, N4, and N5 spectra from [4Fe-4S] clusters . Under extreme reduction conditions, interactions between reduced clusters may be observed as new spectral features with distinctive g values (e.g., g = 2.16) .

What experimental designs are appropriate for studying ND1 function in single-organism contexts?

When investigating the function of ND1 in specific organisms or under particular conditions, N-of-1 experimental designs may be appropriate. These designs involve multiple crossover trials that can be randomized and blinded to assess treatment effects in individual subjects or samples . While traditional N-of-1 trials are used in clinical settings, similar principles can be applied to biochemical studies of proteins like ND1.

For example, researchers might design experiments that:

  • Compare wild-type and mutant forms of ND1 in the same experimental system

  • Assess the effects of specific inhibitors on ND1 function under controlled conditions

  • Evaluate how environmental factors affect ND1 activity in isolated mitochondria

These approaches allow researchers to generate individual treatment effects (ITEs) rather than relying solely on average effects that might obscure important variations .

How can researchers address contradiction-awareness in data analysis when studying complex proteins like ND1?

When analyzing experimental data for complex proteins like ND1, researchers may encounter contradictory results that require careful interpretation. A structured approach to contradiction analysis involves:

  • Systematically evaluating the consistency of datasets using quantitative metrics like "Certainty" and "Variety" to characterize the reliability of findings

  • Using stimulus inputs designed to highlight potential contradictions in the data

  • Clearly distinguishing between non-contradictory and contradictory responses in experimental outcomes

For instance, when analyzing spectroscopic data of ND1's iron-sulfur clusters, researchers might encounter apparently contradictory signals. These could be resolved by considering factors such as:

  • Potential overlapping spectra from different clusters with similar g values

  • Changes to cluster properties under extreme reduction conditions

  • Interactions between adjacent reduced clusters that alter spectral properties

What are common challenges in working with recombinant ND1 and how can they be addressed?

When working with recombinant Asterias forbesii ND1, researchers may encounter several technical challenges:

  • Protein aggregation: As a hydrophobic membrane protein, ND1 may aggregate during purification or experimental procedures. This can be mitigated by:

    • Optimizing detergent type and concentration

    • Maintaining appropriate buffer conditions (pH 8.0 has been established as effective)

    • Using stabilizing agents such as trehalose (6% is recommended)

  • Activity loss during storage: To preserve functional activity:

    • Store as recommended at -20°C to -80°C for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

    • Include glycerol at an appropriate concentration (5-50%)

  • Purity assessment: Ensure protein preparations meet quality standards by:

    • Using SDS-PAGE to confirm purity (should be >90%)

    • Verifying protein identity via mass spectrometry or western blotting

How can researchers validate that their recombinant ND1 maintains native structure and function?

Validating that recombinant ND1 maintains its native structure and function is crucial for experimental reliability. Approaches include:

  • Functional assays:

    • NADH oxidation activity measurements

    • Electron transfer capacity assessments

    • Proton pumping efficiency tests

  • Structural validation:

    • Circular dichroism to assess secondary structure

    • Limited proteolysis to evaluate folding quality

    • Thermal stability assays to determine protein robustness

  • Interaction studies:

    • Co-immunoprecipitation with known binding partners

    • Reconstitution with other Complex I components

    • Membrane insertion efficiency evaluations

What is known about the ecology of Asterias forbesii and how might this inform ND1 research?

Asterias forbesii (Forbes' starfish) is a common sea star species inhabiting the North American Atlantic coast from the Gulf of Maine to the Gulf of Mexico . These organisms thrive in intertidal areas and shallow waters, particularly around rocks, boulders, and bivalve beds . They do not form colonies despite sometimes occurring in abundance . Understanding this ecological context can inform research on ND1 in several ways:

  • The protein may have adaptations to fluctuating oxygen levels experienced in intertidal environments

  • Temperature adaptations in the protein may reflect the organism's geographical distribution

  • Energy metabolism requirements may relate to the species' feeding behavior on bivalve beds

This ecological information provides important context for comparative studies of ND1 across different echinoderm species or other phyla.

How does Asterias forbesii ND1 compare structurally and functionally to homologs in other species?

Comparative analysis of ND1 across species can provide insights into evolutionary conservation and functional adaptation. Researchers interested in such comparisons should consider:

  • Sequence alignment with ND1 proteins from:

    • Other echinoderm species

    • Diverse metazoan lineages

    • Model organisms with well-characterized mitochondrial function

  • Structural comparison focusing on:

    • Conservation of functional domains

    • Variation in transmembrane regions

    • Differences in iron-sulfur cluster binding sites

  • Functional analysis examining:

    • Differences in reduction potentials

    • Variations in electron transfer efficiency

    • Species-specific inhibitor sensitivities

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.