Recombinant Asterina pectinifera ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant ATP6 is a full-length protein (1–230 amino acids) with an N-terminal His tag, enabling purification via metal affinity chromatography. Its UniProt identifier is Q33823, and it shares structural homology with ATP6 proteins in other organisms, including humans and fungi .

ParameterValue
UniProt IDQ33823
Amino Acid Length230
Expression HostE. coli
TagN-terminal His tag
Purity>90% (SDS-PAGE validated)
Storage Conditions-20°C/-80°C (lyophilized powder)
Reconstitution BufferDeionized sterile water (with 5–50% glycerol for long-term storage)

Expression and Recombinant Design

The protein is expressed in E. coli using a recombinant vector. Key steps include:

  1. Cloning: Insertion of the ATP6 gene into a prokaryotic expression vector.

  2. Induction: IPTG-driven expression under optimized growth conditions.

  3. Purification: His-tag affinity chromatography followed by SDS-PAGE validation .

Quality Control

  • Purity: Confirmed by SDS-PAGE to exceed 90% .

  • Stability: Lyophilized format minimizes aggregation; repeated freeze-thaw cycles are avoided.

  • Buffer: Tris/PBS-based buffer with 6% trehalose (pH 8.0) for stabilization .

Evolutionary Conservation

Comparative studies reveal conserved structural motifs in ATP6 across species, including:

  • Helical Domains: Critical for membrane embedding and proton channel formation.

  • Matrix-Exposed Regions: Interact with subunit 8 (ATP8) to regulate stalk flexibility .

Biochemical Studies

Recombinant ATP6 is used to:

  • Study Proton Channel Dynamics: Structural insights into subunit a’s role in proton translocation.

  • Model Mitochondrial Diseases: Mutations in ATP6 (e.g., in humans) are linked to neurodegenerative disorders, such as Leigh syndrome .

Comparative Evolutionary Analysis

SpeciesATP6 Length (aa)Key FeaturesReference
Asterina pectinifera230Shorter N-terminal region; starfish-specific adaptations
Homo sapiens226Mutations linked to mitochondrial encephalopathies
Podospora anserina264Fungal-specific elongated C-terminal domain

Key Differences Between Species

  1. Amino Acid Length:

    • Asterina pectinifera (230 aa) vs. Podospora anserina (264 aa) .

  2. Proton Translocation Efficiency:

    • Asterina ATP6 may exhibit unique adaptations for cold-water environments, as seen in Antarctic icefish .

Mutational Impact

Mutations in ATP6 disrupt proton channel function, leading to reduced ATP synthase activity. For example:

  • Human ATP6 Mutations: Replace conserved residues (e.g., R159) critical for proton gating, causing mitochondrial dysfunction .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we are happy to accommodate specific requirements. Please include your desired format in the order notes, and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Patiria pectinifera (Starfish) (Asterina pectinifera)
Target Names
ATP6
Target Protein Sequence
MNLNLNSIFGQFSPDLVLFIPMTLTAVFLNLSWLSISNPSNWLPSRANLLILSFYQEVLK ILFQQTNPNTAPWVSAFTAIFILIFSINVLGLLPYAFTSTSHISLTYSIGVPLWMSVNIL GFYLAFNSRLGHLVPQGTPSYLIPFMVIIETISLFAQPIALGLRLAANLTAGHLLIFLLS TAIWTLSSSPSIASITLLIFFFLFLLEIGVACIQAYVFTALVNFYLSQNL
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane. This gradient is established by electron transport complexes within the respiratory chain. F-type ATPases consist of two structural domains: F(1), which houses the extramembraneous catalytic core, and F(0), which contains the membrane proton channel. These domains are connected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the F(1) catalytic domain is coupled to proton translocation via a rotary mechanism of the central stalk subunits. ATP synthase subunit a is a key component of the proton channel and may play a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (ATP6) and what is its function in Asterina pectinifera?

ATP synthase subunit a, encoded by the ATP6 gene, is a crucial component of the F0 domain of ATP synthase, a rotary nano-machine responsible for ATP production. In Asterina pectinifera (also known as Patiria pectinifera, a starfish species), ATP6 forms part of the proton translocation pathway that drives ATP synthesis. This subunit provides the proton path from the exterior membrane surface to the carboxylates of interacting c-subunits of the rotor . The a-subunit contains an essential conserved arginine that prevents proton short-circuiting to the cytoplasm without rotation and helps regulate the pKa of essential carboxylate groups . Without proper functioning of the a-subunit, proton translocation and subsequent ATP production would be compromised. The complete ATP6 protein in A. pectinifera is 230 amino acids long and functions within the mitochondrial membrane to maintain cellular energy homeostasis .

What are the optimal storage conditions for recombinant Asterina pectinifera ATP6 in research settings?

For optimal research outcomes, recombinant Asterina pectinifera ATP6 requires specific storage conditions:

Storage ParameterRecommended ConditionNotes
Buffer compositionTris-based buffer with 50% glycerolOptimized specifically for this protein
Storage temperature-20°CFor routine storage
Long-term storage-20°C or -80°CFor extended preservation
Working aliquots4°CMaintain for up to one week only
Freeze-thaw cyclesMinimizeRepeated freezing and thawing not recommended

These storage parameters help maintain protein stability and functional integrity for experimental applications . The high glycerol content serves as a cryoprotectant that prevents damage during freezing while maintaining protein solubility.

How do mutations in ATP6 affect ATP synthase function and what experimental approaches are used to study these effects?

Mutations in ATP6 can significantly alter ATP synthase function, with implications for energy metabolism and cellular physiology. Studies on bacterial ATP synthase a-subunit provide valuable insights that can be applied to research on A. pectinifera ATP6 .

Key experimental approaches include:

  • Site-directed mutagenesis targeting conserved residues (e.g., K180A, K180C, K180G, K180H, K180R, K180G/G212K)

  • Recombinant protein expression in suitable host systems

  • ATP synthesis activity assays under varying conditions

  • Proton translocation measurements using pH-sensitive probes

  • Structural analysis through biochemical and genetic approaches

Research has shown that the a-subunit plays critical roles in providing the proton path from outside the membrane to c-subunits of the rotor . The conserved arginine in transmembrane helix 4 (TMH4) is particularly important for preventing proton short-circuiting and causing a shift in the pKa of essential carboxylates . Mutations in these key residues can disrupt proton translocation, affecting the efficiency of ATP synthesis or completely abolishing function.

A systematic approach would involve creating multiple mutations, expressing the mutant proteins, and conducting functional assays to determine how specific amino acid substitutions affect various aspects of ATP synthase activity.

What is the relationship between ATP6 and immunological self-recognition in Patiria pectinifera?

While the search results don't directly connect ATP6 to immunological recognition in P. pectinifera, research on the establishment of immunological self in this organism provides context for potential investigations.

P. pectinifera establishes its immunological self post-metamorphosis during the juvenile stage . Adult immune cells (coelomocytes) can recognize and phagocytose injected allogeneic cells, forming aggregates in response to foreign material . In contrast, larval immune systems are tolerant to non-related allogeneic cells .

Investigating potential relationships between ATP6 and immunological recognition could involve:

  • Analyzing ATP6 expression changes during the transition from larvae to juvenile stages

  • Determining whether ATP6 variants correlate with allorecognition patterns

  • Using recombinant ATP6 to test immune cell responses

  • Creating chimeras with different ATP6 variants to assess immune tolerance

Research has demonstrated that allorecognition ability in P. pectinifera is established at the post-metamorphic juvenile stage, during continued tissue organization to the adult body structure . The timing of this development coincides with significant physiological changes that could involve mitochondrial proteins like ATP6.

How do structural variations in ATP6 relate to environmental adaptations in different organisms?

Structural variations in ATP6 can lead to functional adaptations that allow organisms to thrive in specific environments. Research on alkaliphilic bacteria provides insight into how ATP6 structure can be modified for environmental adaptation .

In extreme alkaliphiles, the ATP synthase a-subunit contains distinctive features, such as a lysine residue in the proton uptake pathway that is not found in non-alkaliphilic ATP synthases . This adaptation likely facilitates ATP synthesis under alkaline conditions.

For marine organisms like A. pectinifera, ATP6 may contain adaptations for optimal function in seawater, which has:

  • Higher salinity than freshwater

  • Different ion composition

  • Unique pH buffering properties

Methodological approaches to study environmental adaptations include:

  • Comparative sequence analysis of ATP6 from organisms in different environments

  • Identification of environment-specific amino acid substitutions

  • Site-directed mutagenesis to introduce or remove these residues

  • Functional assays under varying conditions (pH, salinity, temperature)

  • Structural modeling of proton pathways

The specific amino acid composition of A. pectinifera ATP6 might reveal adaptations for optimal function in marine environments, potentially including modifications to proton channels or binding sites for other subunits.

What methods are used to analyze ATP6 expression in different developmental stages of Asterina pectinifera?

Analyzing ATP6 expression across developmental stages requires sophisticated molecular techniques. Based on developmental biology research with P. pectinifera, appropriate methods would include:

TechniqueApplicationAdvantage
Quantitative RT-PCRPrecise measurement of ATP6 transcript levelsHigh sensitivity for detecting small expression changes
RNA-SeqTranscriptome-wide analysisPlaces ATP6 expression in context with other genes
In situ hybridizationLocalization of ATP6 transcriptsProvides spatial information about expression
ImmunohistochemistryVisualization of ATP6 proteinShows protein localization in tissue sections
Western blottingQuantification of ATP6 proteinMeasures actual protein levels

An experimental design for developmental expression analysis would involve:

  • Collecting samples at key developmental timepoints (embryo, larvae, post-metamorphic juvenile, adult)

  • Processing samples for RNA and protein extraction

  • Performing expression analyses using the techniques above

  • Correlating expression changes with developmental transitions, particularly metamorphosis

P. pectinifera undergoes significant physiological changes during metamorphosis from larval to juvenile stages, including the establishment of immunological self . Understanding ATP6 expression patterns during this transition could provide insights into energy metabolism changes accompanying these developmental processes.

How can chimeric approaches be used to study ATP6 function in Patiria pectinifera?

Chimeric approaches offer powerful tools for studying ATP6 function in P. pectinifera. Research has shown that this species can form stable chimeras at early developmental stages, providing opportunities for innovative experimental designs .

Methodology for chimeric studies of ATP6 could include:

  • Creation of chimeras from dissociated cells derived from embryos with different ATP6 variants

  • Fluorescent labeling of different cell populations to track their distribution in the chimera

  • Analysis of ATP6 expression and function in different regions of the chimera

  • Assessment of mitochondrial function in chimeric tissues

  • Electron microscopy to examine ultrastructural characteristics of mitochondria in chimeric organisms

Research has demonstrated that P. pectinifera can form stable chimeras from mixed dissociated cells, even between non-related individuals . In chimeric reconstructed embryos, fluorescent signals from different cell populations distribute in a patchy fashion, indicating that cells from different sources tend to accumulate separately .

This chimeric approach could be particularly valuable for understanding how different ATP6 variants function within the same organism, potentially revealing interactions between mitochondrial and nuclear genomes or tissue-specific adaptations of ATP synthase function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.