Recombinant Asterina pectinifera Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Description

Physical Properties

  • Storage conditions:

    • Short-term: -20°C in Tris-based buffer with 50% glycerol .

    • Long-term: -80°C; avoid repeated freeze-thaw cycles .

  • Stability: Working aliquots remain stable at 4°C for ≤1 week .

Functional Assays

While direct enzymatic activity data for this recombinant protein are not publicly disclosed, COII homologs exhibit:

  • Electron transfer rate: ~1,000 e⁻/sec in mammalian systems .

  • Inhibition: Sensitive to cyanide and nitric oxide, typical of cytochrome c oxidase subunits .

Mitochondrial Dysfunction Studies

Recombinant COII enables:

  • Site-directed mutagenesis: To probe residues involved in proton translocation (e.g., CuA-binding histidines) .

  • Structural biology: Crystallization trials for resolving electron transport mechanisms .

Evolutionary Biology

  • Sequence divergence analysis: COII’s high conservation across species (e.g., 80% identity between A. pectinifera and human homologs) makes it a marker for studying mitochondrial genome evolution .

Limitations and Future Directions

  • Functional data gaps: Kinetic parameters (e.g., KmK_m, VmaxV_{max}) for the recombinant protein remain uncharacterized.

  • Comparative studies: Cross-species activity assays (e.g., with human COX2) could validate its utility in biomedical research .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Patiria pectinifera (Starfish) (Asterina pectinifera)
Target Names
COII
Target Protein Sequence
MANWTQLGLQDASSPLMEELIYFHDYTLIILTLITILVFYGLASLLFSSNTNRFFLEGQG LETVWTIIPAVILIFIALPSLQLLYLMDEVNNPYLTIKAIGHQWYWSYEYADYRELEFDS YMIPTSDLTSGNPRLLEVDNRLTLPAQTPIRVLVSSADVLHSWAIPSLGIKMDAVPGRLN QVNFFISRCGLFYGQCSEICGANHSFMPIVIESVNFSTFETWVSNFITE
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprising succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. COII plays a crucial role in this process; it contributes to the electron transfer from reduced cytochrome c in the intermembrane space (IMS) to the active site within subunit 1. This active site, a binuclear center (BNC) comprising heme a3 and copper B (CuB), catalyzes the reduction of oxygen to water, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix. The electron transfer pathway involves the dinuclear copper A center (CuA) of subunit 2 and heme a of subunit 1.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of Cytochrome c oxidase subunit 2 in cellular respiration?

Cytochrome c oxidase subunit 2 (COII) plays a critical role in cellular respiration as it is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX). This electron transfer is essential to the production of ATP during oxidative phosphorylation. The protein is highly conserved across species due to its integral function in the electron transport chain . As a component of Complex IV (cytochrome c oxidase), COII contains copper centers that facilitate the transfer of electrons, making it a crucial link in the mitochondrial respiratory chain. The specific arrangement of amino acids in COII creates binding sites for both cytochrome c and other subunits of the COX complex, enabling efficient electron flow during respiration.

How should recombinant Asterina pectinifera COII be stored and handled for optimal experimental results?

For optimal experimental outcomes, recombinant Asterina pectinifera COII should be stored at -20°C, or at -80°C for extended storage periods. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for stability . When working with the protein, it is advisable to:

  • Avoid repeated freeze-thaw cycles as these can compromise protein integrity

  • Prepare working aliquots that can be stored at 4°C for up to one week

  • Handle the protein on ice when preparing experimental solutions

  • Maintain sterile conditions to prevent contamination

  • Use appropriate buffer conditions that maintain protein stability during experiments

For experimental procedures requiring extended incubation times, it is recommended to verify protein stability under the specific experimental conditions prior to conducting full-scale experiments.

What experimental techniques are most appropriate for studying the functional activity of recombinant COII?

Several experimental approaches are well-suited for studying the functional activity of recombinant COII:

  • Spectrophotometric assays: Measuring electron transfer rates using cytochrome c oxidation/reduction kinetics

  • Oxygen consumption assays: Quantifying respiratory activity using oxygen electrodes

  • Biochemical interaction studies: Assessing protein-protein interactions between COII and cytochrome c using techniques such as co-immunoprecipitation, surface plasmon resonance, or yeast two-hybrid assays

  • Site-directed mutagenesis: Evaluating the impact of specific amino acid substitutions on electron transfer efficiency

  • Reconstitution experiments: Incorporating recombinant COII into liposomes or nanodiscs to study its function in a membrane environment

Each of these approaches provides unique insights into different aspects of COII function, and combining multiple techniques often yields the most comprehensive understanding of the protein's role in electron transport.

How does the evolutionary conservation pattern of COII in Asterina pectinifera compare with other marine invertebrates, and what implications does this have for understanding selective pressures?

The evolutionary conservation pattern of COII shows interesting variations across marine invertebrates. While COII is generally highly conserved due to its critical role in electron transport, research on the marine copepod Tigriopus californicus has revealed extensive intraspecific nucleotide and amino acid variation, with interpopulation divergence reaching nearly 20% at the nucleotide level, including 38 nonsynonymous substitutions . This suggests that despite functional constraints, certain taxonomic groups exhibit unexpected levels of variation.

In Asterina pectinifera, the conservation pattern must be analyzed in the context of its evolutionary history and ecological niche. Unlike T. californicus, which shows high interpopulation divergence but minimal intrapopulation variation, starfish species may exhibit different patterns. Analysis using maximum likelihood models of codon substitution similar to those applied in T. californicus would reveal whether COII in A. pectinifera follows the typical pattern where the majority of codons are under strong purifying selection (ω << 1) with only a small percentage (approximately 4% in T. californicus) evolving under relaxed selective constraint (ω = 1) .

The implications of these patterns include:

  • Potential co-evolution with nuclear-encoded interacting proteins

  • Adaptation to specific thermal or environmental conditions

  • Possible functional consequences for hybrid organisms

  • Insights into speciation mechanisms in marine environments

Understanding these patterns can inform broader questions about mitonuclear co-evolution and the molecular basis of adaptation in marine invertebrates.

What are the methodological challenges in expressing and purifying functionally active recombinant Asterina pectinifera COII, and how can these be overcome?

Expression and purification of functionally active recombinant Asterina pectinifera COII presents several significant methodological challenges:

  • Membrane protein expression: As a mitochondrial membrane protein, COII contains hydrophobic domains that can cause misfolding, aggregation, or toxicity when expressed in conventional systems.

  • Post-translational modifications: Ensuring proper copper incorporation at the CuA site is critical for electron transfer function.

  • Maintaining native conformation: Preserving the structural integrity necessary for interaction with cytochrome c and other COX subunits.

  • Detergent selection: Identifying detergents that solubilize the protein without denaturing it.

These challenges can be addressed through the following methodological approaches:

ChallengeSolution ApproachKey Considerations
Membrane protein expressionUse specialized expression systems (P. pastoris, insect cells, cell-free systems)Select systems with appropriate folding machinery
Copper incorporationSupplement expression media with copper; co-express copper chaperonesMonitor copper loading spectroscopically
Native conformationExpress with interacting partners; use mild solubilizationVerify structure by circular dichroism or limited proteolysis
Detergent selectionScreen detergent panel (DDM, LDAO, Fos-choline)Test functional activity in each detergent condition
Purification strategyTwo-step affinity chromatography followed by size exclusionMinimize exposure to harsh conditions

A particularly effective approach combines the use of fusion tags (such as SUMO or MBP) to enhance solubility, followed by reconstitution into nanodiscs or liposomes for functional studies. The addition of stabilizing agents such as glycerol and specific lipids during purification can significantly improve protein stability and functional yield.

How can recombinant COII be utilized to investigate mitonuclear incompatibility in hybrid systems, and what experimental controls are critical?

Recombinant COII provides a powerful tool for investigating mitonuclear incompatibility in hybrid systems, which is particularly relevant given the findings in Tigriopus californicus where functional and fitness consequences were observed among interpopulation hybrids between central and northern California populations . To utilize recombinant COII effectively:

Experimental Approach:

  • In vitro reconstitution studies: Combine recombinant COII from one population with nuclear-encoded COX subunits from another population to measure electron transfer efficiency.

  • Complementation experiments: Introduce recombinant COII into hybrid cells with respiratory deficiencies to assess rescue effects.

  • Binding affinity measurements: Quantify interaction strengths between COII variants and partner proteins using surface plasmon resonance or isothermal titration calorimetry.

  • Respiratory function assessment: Measure oxygen consumption rates in hybrid systems with different COII variants.

Critical Experimental Controls:

  • Homologous protein controls: Include experiments with COII and nuclear-encoded partners from the same population.

  • Enzymatic activity controls: Verify that recombinant COII retains native catalytic activity before hybrid experiments.

  • Expression level normalization: Ensure comparable expression levels when comparing different COII variants.

  • Temperature controls: Perform experiments across a range of temperatures to detect thermal sensitivity of incompatibilities.

  • Multiple independent replicates: Use biological replicates from different expression batches to control for preparation artifacts.

This approach can reveal molecular mechanisms underlying hybrid breakdown and provide insights into the evolutionary forces driving mitonuclear co-adaptation, particularly in marine invertebrates where population structure and local adaptation may play important roles.

What insights can structural analysis of Asterina pectinifera COII provide about the molecular mechanisms of electron transfer and potential species-specific adaptations?

Structural analysis of Asterina pectinifera COII can reveal crucial insights about electron transfer mechanisms and species-specific adaptations that may have evolved in response to particular environmental pressures. Key aspects that can be investigated include:

  • CuA binding domain structure: The precise coordination of copper in the CuA site is essential for electron transfer. Structural analysis can reveal whether A. pectinifera has evolved unique features in this domain that might affect electron transfer efficiency or redox potential.

  • Interaction interfaces: The surfaces where COII interacts with cytochrome c and other COX subunits determine the efficiency of complex formation and electron transfer. Species-specific variations in these interfaces could reflect adaptations to different environmental conditions.

  • Membrane-spanning regions: The transmembrane helices of COII anchor it within the mitochondrial membrane. Structural variations in these regions might reflect adaptations to different membrane compositions or biophysical properties.

  • Conformational dynamics: Beyond static structure, the dynamics of COII during electron transfer can be studied using techniques such as hydrogen-deuterium exchange mass spectrometry or molecular dynamics simulations.

Methodological approaches should include:

  • X-ray crystallography or cryo-electron microscopy of the isolated protein or complete COX complex

  • Molecular dynamics simulations comparing A. pectinifera COII with homologs from other species

  • Site-directed spin labeling combined with electron paramagnetic resonance spectroscopy to map dynamic regions

  • Computational prediction of electron transfer pathways based on structural data

These analyses can be particularly informative when conducted in a comparative framework, contrasting A. pectinifera COII with homologs from species adapted to different thermal regimes, depths, or other ecological conditions.

How might the function of Asterina pectinifera COII be affected by environmental stressors such as temperature, pH, or pollutants, and what experimental designs best address these questions?

The function of Asterina pectinifera COII may be significantly impacted by environmental stressors, particularly given its critical role in energy metabolism. Investigating these effects requires carefully designed experiments:

Temperature Effects:
Given that starfish inhabit various thermal environments, COII function may display temperature-dependent characteristics. Temperature changes can affect:

  • Protein stability and folding

  • Rates of electron transfer

  • Interaction affinity with cytochrome c

  • Complex assembly with other COX subunits

Experimental Design: Measure electron transfer kinetics and oxygen consumption at temperatures ranging from 5-35°C, creating thermal performance curves. Compare these with environmental data from A. pectinifera's natural habitat to assess thermal adaptation.

pH Effects:
Ocean acidification represents a significant environmental stressor that may affect COII function through:

  • Altered protonation states of key residues

  • Changes in protein conformation

  • Modified interaction properties with partner proteins

Experimental Design: Assess COII activity across pH gradients (pH 6.5-8.0) using spectrophotometric assays of electron transfer and oxygen consumption. Include experiments with transient pH changes to model fluctuating conditions.

Pollutant Effects:
Heavy metals and organic pollutants may interfere with COII function by:

  • Competing with copper at the CuA site

  • Inducing oxidative damage to key residues

  • Causing conformational changes through binding

Experimental Design: Expose recombinant COII to environmentally relevant concentrations of common marine pollutants (copper, mercury, PAHs), then measure changes in:

  • Spectroscopic properties of the CuA site

  • Electron transfer efficiency

  • Binding affinity for cytochrome c

  • Protein stability and aggregation tendency

The table below outlines a comprehensive experimental approach:

Environmental StressorParameter RangeMeasurement TechniquesControls Required
Temperature5-35°C in 5°C incrementsOxygen consumption, cytochrome c oxidation kineticsThermal stability assessment prior to activity measurements
pHpH 6.5-8.0 in 0.25 unit incrementsSpectrophotometric assays, fluorescence spectroscopyBuffer controls with identical ionic strength
Heavy Metals0.1-100 μM Cu, Hg, CdICP-MS for metal binding, activity assaysMetal chelator recovery experiments
Organic Pollutants0.1-50 μM PAHs, PCBsFluorescence quenching, activity assaysSolvent controls (DMSO, ethanol)

By systematically applying these experimental approaches, researchers can develop a comprehensive understanding of how A. pectinifera COII responds to environmental stressors, providing insights into potential mechanisms of adaptation and vulnerability in a changing marine environment.

What are the best approaches for assessing the purity and integrity of recombinant Asterina pectinifera COII preparations?

Ensuring the purity and integrity of recombinant Asterina pectinifera COII preparations is critical for obtaining reliable experimental results. Multiple complementary techniques should be employed:

Purity Assessment:

  • SDS-PAGE: Using Coomassie or silver staining to visualize protein bands, with >95% purity generally considered acceptable for most functional studies. For membrane proteins like COII, specialized gel systems such as Tricine-SDS-PAGE may provide better resolution.

  • Western blotting: Using antibodies specific to COII or affinity tags to confirm identity and detect potential degradation products.

  • Size-exclusion chromatography (SEC): Analyzing the homogeneity of the protein preparation and detecting aggregates or oligomeric states.

  • Mass spectrometry: Providing accurate mass determination and the ability to identify post-translational modifications or truncations:

    • MALDI-TOF for intact mass analysis

    • LC-MS/MS for peptide mapping and sequence coverage verification

Integrity Assessment:

  • Circular dichroism (CD) spectroscopy: Evaluating secondary structure content and proper folding.

  • Fluorescence spectroscopy: Assessing tertiary structure integrity through intrinsic tryptophan fluorescence.

  • Thermal shift assays: Measuring protein stability and the effects of different buffer conditions.

  • Functional assays: Confirming that the protein retains its electron transfer capability:

    • Cytochrome c oxidation rate measurements

    • Copper content quantification using atomic absorption spectroscopy

A systematic quality control workflow might include:

StageTechniqueAcceptance Criteria
Initial screeningSDS-PAGE>95% purity, correct MW (25-30 kDa)
Identity confirmationWestern blotSingle band at expected MW
Homogeneity assessmentSEC-MALS>90% monodispersity
Structural integrityCD spectroscopySpectrum consistent with mixed α-helical/β-sheet content
Functional verificationCytochrome c oxidationActivity within 80% of native enzyme
Metal contentICP-MS or atomic absorption2 Cu atoms per protein molecule

Implementing this comprehensive quality control strategy ensures that experiments utilize properly folded, functionally competent COII protein, thereby increasing the reliability and reproducibility of subsequent studies.

What strategies can be employed to investigate the interaction between recombinant COII and other components of the respiratory chain?

Investigating interactions between recombinant COII and other respiratory chain components requires multiple complementary approaches to capture both physical associations and functional consequences. The following strategies provide a comprehensive framework:

Physical Interaction Studies:

  • Co-immunoprecipitation (Co-IP): Using antibodies against COII or interacting partners to pull down protein complexes. This technique works well for stable interactions but may miss transient associations.

  • Surface Plasmon Resonance (SPR): Providing quantitative binding kinetics by immobilizing either COII or its partner protein on a sensor chip and flowing the other component over it. This method can determine kon, koff, and KD values.

  • Isothermal Titration Calorimetry (ITC): Offering direct measurement of binding thermodynamics (ΔH, ΔS, and stoichiometry) in solution without requiring protein modification.

  • Microscale Thermophoresis (MST): Detecting binding through changes in thermophoretic mobility, requiring minimal protein amounts and tolerating various buffer conditions.

  • Chemical Cross-linking coupled with Mass Spectrometry (XL-MS): Identifying interaction interfaces by covalently linking proteins in close proximity and analyzing the resulting peptides.

Functional Interaction Studies:

  • Reconstitution Experiments: Incorporating purified COII and partner proteins into liposomes or nanodiscs to measure electron transfer efficiency.

  • Oxygen Consumption Assays: Quantifying the functional output of reconstructed respiratory chain components using oxygen electrodes.

  • Electron Transfer Kinetics: Measuring the rates of electron movement between COII and its partners using stopped-flow spectroscopy.

  • Mutagenesis Studies: Introducing specific mutations at predicted interaction interfaces to identify critical residues.

Structural Studies of Complexes:

  • Cryo-Electron Microscopy: Visualizing the architecture of COII within larger respiratory complexes at near-atomic resolution.

  • X-ray Crystallography: Determining high-resolution structures of COII in complex with interaction partners.

  • Nuclear Magnetic Resonance (NMR): Mapping interaction surfaces through chemical shift perturbations upon complex formation.

An integrated experimental workflow might proceed as follows:

  • Initial screening of potential interactions using pull-down assays

  • Confirmation and quantification of direct binding using SPR or ITC

  • Identification of interaction interfaces through XL-MS or hydrogen-deuterium exchange MS

  • Functional validation through reconstitution experiments

  • Structural characterization of complexes by cryo-EM or X-ray crystallography

  • Targeted mutagenesis to confirm the importance of specific residues

This multi-technique approach provides a comprehensive understanding of both structural and functional aspects of COII interactions within the respiratory chain.

How can researchers effectively design experiments to compare the functional properties of COII from different marine invertebrate species?

Designing comparative experiments to investigate functional differences in COII across marine invertebrate species requires careful consideration of evolutionary relationships, environmental adaptations, and methodological consistency. An effective experimental design should include:

Species Selection Strategy:

  • Phylogenetic approach: Include species with varying evolutionary distances to identify conserved versus divergent functional properties.

  • Ecological approach: Select species from different thermal environments, depths, or oxygen conditions to examine adaptive variations.

  • Conservation pattern approach: Include species with known differences in COII sequence conservation to test structure-function hypotheses.

A well-designed species comparison might include:

  • Asterina pectinifera as the focal species

  • Close relatives within Asteroidea

  • More distant echinoderms

  • Representatives from other marine invertebrate phyla

  • Species from extreme environments (deep sea, hydrothermal vents)

Standardized Expression and Purification:

To ensure valid comparisons, all COII proteins must be:

  • Expressed in the same heterologous system

  • Purified using identical protocols

  • Verified for comparable purity and integrity

  • Quantified using the same methods

Functional Comparison Framework:

Functional PropertyMeasurement TechniqueParameters to Compare
Electron transfer efficiencyCytochrome c oxidation kineticskcat, KM, catalytic efficiency (kcat/KM)
Thermal stabilityDifferential scanning calorimetryMelting temperature (Tm), enthalpy of unfolding (ΔH)
pH sensitivityActivity assays across pH rangepH optima, activity retention profiles
Oxygen affinityOxygen consumption measurementsKM for O2, maximum consumption rate
Partner protein interactionsSurface plasmon resonanceBinding affinities (KD), association/dissociation rates
ROS productionFluorescent probes (e.g., Amplex Red)H2O2 generation rates under defined conditions

Critical Controls and Normalization:

  • Ensure equal amounts of active protein through active site titration

  • Normalize activities to copper content

  • Include temperature controls relevant to each species' natural habitat

  • Test each protein across the same range of conditions, regardless of native environment

  • Use common reference proteins (e.g., human or bovine COII) across all experiments

Data Analysis and Interpretation:

  • Plot functional parameters against phylogenetic distance to distinguish between neutral evolution and adaptation

  • Correlate functional differences with specific amino acid substitutions

  • Map variations onto structural models to identify potential mechanistic explanations

  • Consider environmental parameters from source habitats when interpreting differences

By implementing this systematic approach, researchers can distinguish between species differences that represent neutral evolutionary divergence versus those that reflect functional adaptations to specific environmental conditions, providing insights into both the evolution of COII and its role in environmental adaptation.

How can recombinant Asterina pectinifera COII be used as a model system for studying mitochondrial dysfunction in human diseases?

Recombinant Asterina pectinifera COII presents a valuable model system for investigating mitochondrial dysfunction relevant to human diseases, despite evolutionary distance. This approach leverages both the conserved functional aspects of COII and the unique features that make it experimentally advantageous:

Comparative Advantage as a Model System:

  • Structural homology: The core functional domains of COII are highly conserved across species, making A. pectinifera COII a suitable proxy for studying fundamental electron transport mechanisms relevant to human mitochondrial function .

  • Experimental tractability: A. pectinifera COII can be expressed and purified in higher yields than human COII, facilitating structural and functional studies that might be challenging with human proteins.

  • Evolutionary insights: Comparative studies between A. pectinifera and human COII can highlight which residues are absolutely essential for function versus those that permit variation, informing the interpretation of human disease mutations.

Experimental Applications for Human Disease Research:

  • Mutation modeling: Introducing mutations corresponding to human disease variants into recombinant A. pectinifera COII to assess functional consequences:

    Human Disease MutationCorresponding A. pectinifera PositionFunctional Assessment
    Disease variant M29KIdentify homologous positionElectron transfer efficiency
    Disease variant W105KIdentify homologous positionComplex assembly, stability
    Disease variant R159WIdentify homologous positionCytochrome c binding
  • Drug screening platform: Using recombinant A. pectinifera COII to identify compounds that restore function to mutant variants or enhance wild-type activity.

  • ROS production studies: Investigating how mutations affect reactive oxygen species generation, a key pathogenic mechanism in mitochondrial diseases.

  • Protein-protein interaction analysis: Mapping interaction surfaces between COII and other respiratory components, identifying sites vulnerable to disease-causing mutations.

Methodological Approach:

  • Create a comprehensive alignment between human and A. pectinifera COII to identify structurally and functionally equivalent positions

  • Generate recombinant A. pectinifera COII variants mimicking human disease mutations

  • Assess multiple functional parameters for each variant:

    • Electron transfer rates

    • Protein stability

    • Assembly with other respiratory complex components

    • ROS production

  • Validate findings using complementary approaches such as in silico modeling and, where possible, studies in human cells

This model system approach can provide mechanistic insights into how COII mutations contribute to mitochondrial disorders such as mitochondrial encephalomyopathy, Leigh syndrome, and aspects of neurodegenerative diseases with mitochondrial involvement, while overcoming some of the experimental limitations associated with direct studies of human mitochondrial proteins.

What potential biotechnological applications exist for recombinant COII proteins from marine invertebrates like Asterina pectinifera?

Recombinant COII proteins from marine invertebrates like Asterina pectinifera offer several innovative biotechnological applications that leverage their unique properties and evolutionary adaptations:

Bioenergetic Applications:

  • Biofuel cells: The efficient electron transfer capabilities of COII can be harnessed to develop enzymatic biofuel cells with improved electron transfer rates. A. pectinifera COII may offer advantages in stability or catalytic efficiency compared to mammalian counterparts.

  • Biosensors: COII-based electrochemical biosensors can detect substances that interact with the electron transport chain, such as inhibitors or toxins. The marine invertebrate origin may provide greater stability under varying conditions compared to mammalian systems.

Therapeutic Development:

  • Mitochondrial replacement therapy models: A. pectinifera COII can serve as a model system for developing approaches to replace defective mitochondrial components in human disease.

  • Drug discovery platform: Screening compounds that modulate COII function to identify potential therapeutics for mitochondrial disorders.

Environmental Applications:

  • Biomonitoring tools: Developing COII-based assays to detect marine pollutants that disrupt mitochondrial function, particularly relevant given that A. pectinifera inhabits marine environments where such pollution occurs.

  • Bioremediation: Engineered systems incorporating COII to detoxify specific environmental contaminants through electron transfer processes.

Advanced Materials:

  • Bio-inspired electronic components: The natural electron transfer properties of COII can inspire development of bio-electronic interfaces and molecular wires with enhanced efficiency.

  • Immobilized enzyme systems: COII immobilized on electrodes or nanoparticles for specialized catalytic applications.

Methodological Considerations for Biotechnological Development:

Application AreaKey Technical RequirementsAdvantages of A. pectinifera COII
Biofuel cellsStable immobilization on electrodes, retention of activity in non-physiological conditionsPotential adaptation to diverse environmental conditions
BiosensorsSpecific signal transduction, reproducible responseEvolutionary distance provides unique selectivity profiles
Therapeutic modelsFunctional interaction with human system componentsStructural insights into conserved mechanisms
Environmental monitoringSensitivity to relevant pollutants, robust performanceEvolved in marine environments, relevant ecological context
Bio-inspired materialsStable activity when incorporated into synthetic matricesUnique amino acid composition may offer novel properties

The development of these applications requires:

  • Optimization of expression systems for scale-up production

  • Protein engineering to enhance desired properties (stability, specificity)

  • Development of appropriate immobilization strategies

  • Thorough characterization of performance under application-relevant conditions

  • Comparative studies with human and other model species' COII to identify unique advantages

By exploring these biotechnological applications, researchers can translate fundamental knowledge about A. pectinifera COII into practical innovations while simultaneously advancing our understanding of this important protein's structure-function relationships.

What are the most significant unresolved questions regarding Asterina pectinifera COII that present opportunities for future research?

Despite considerable progress in understanding cytochrome c oxidase subunit 2 from various species, several significant unresolved questions regarding Asterina pectinifera COII represent important opportunities for future research:

  • Structural-functional relationships: While the amino acid sequence is known , a high-resolution structure of A. pectinifera COII has not been determined. This structural information is critical for understanding species-specific adaptations and potential biotechnological applications.

  • Evolutionary adaptation mechanisms: The specific selective pressures that have shaped A. pectinifera COII evolution remain unclear. Research in other species like Tigriopus californicus has revealed significant variation and evidence of positive selection , but whether similar patterns exist in A. pectinifera is unknown.

  • Mitonuclear co-evolution: The interaction between mitochondrial-encoded COII and nuclear-encoded partners in A. pectinifera has not been fully characterized. Understanding this co-evolution is crucial for interpreting how mitochondrial function is maintained across evolutionary time.

  • Environmental adaptation: How A. pectinifera COII function responds to environmental stressors relevant to marine ecosystems (temperature fluctuations, ocean acidification, pollution) remains largely unexplored.

  • Comparative biochemistry: Direct comparisons of the kinetic and thermodynamic properties of A. pectinifera COII with those of other marine invertebrates and vertebrates would provide valuable insights into the evolution of mitochondrial function.

  • Biotechnological potential: The full range of potential applications for recombinant A. pectinifera COII in biotechnology, bioenergy, and biomedical research has yet to be systematically explored.

These research opportunities could be addressed through integrative approaches combining structural biology, biochemistry, molecular evolution, and comparative physiology. Such studies would not only advance our understanding of this specific protein but also contribute to broader knowledge about mitochondrial function, adaptation, and evolution in marine invertebrates.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.