Recombinant Asterina pectinifera NADH-ubiquinone oxidoreductase chain 3 (ND3)

What is the basic structure and function of Asterina pectinifera ND3 protein?

Asterina pectinifera NADH-ubiquinone oxidoreductase chain 3 (ND3) is a mitochondrial protein component of Complex I in the electron transport chain. The full-length protein consists of 116 amino acids with the sequence: "MIYTNNIFNFLTLFVSILIFLITTLITFAAHFLPSRNTDSEKSSPYECGFDPLNSARVPFSFRFFLVAILFLLFDLEIALLFPLPFSVFFHPIHTPLILTVGLIFEWVQGGLDWAE" . As a component of Complex I, ND3 participates in the first step of the electron transport chain, facilitating the transfer of electrons from NADH to ubiquinone and contributing to the proton gradient used for ATP synthesis.

To study this protein, researchers typically express it recombinantly with tags such as histidine (His-tag) to facilitate purification and downstream applications . The hydrophobic nature of this protein, typical of mitochondrial membrane proteins, presents specific challenges for expression and purification that must be addressed in experimental design.

How does the nucleotide sequence of ND3 differ between Asterina pectinifera and related asteroid species?

Comparative genomic analyses reveal significant differences in the ND3 gene sequence between Asterina pectinifera and related species such as Acanthaster planci and Acanthaster brevispinus. Notably, the nucleotide sequence of the ND3 gene in A. pectinifera is 18 bp shorter than those of both Acanthaster counterparts . Most of these deletions are observed near the 3' end of the gene .

These differences reflect evolutionary divergence and potentially functional adaptations. When analyzing ND3 sequences across asteroid species, researchers should be mindful of these variations, especially when:

• Designing primers for PCR amplification

• Conducting phylogenetic analyses

• Interpreting functional differences in the expressed proteins

The strand-specific nucleotide composition bias observed in mitochondrial DNA of A. pectinifera (where the L strand prefers to use A or C while the H strand prefers to use G or T in the third codons) is also present in Acanthaster species, suggesting a conserved pattern among asteroids .

What are the optimal expression conditions for recombinant Asterina pectinifera ND3 protein in E. coli?

For optimal expression of recombinant Asterina pectinifera ND3 protein in E. coli, researchers should consider the following methodological approach:

• Vector selection: Use expression vectors containing strong promoters (T7, tac) and appropriate fusion tags (His-tag is commonly used for ND3) .

• E. coli strain selection: BL21(DE3) or Rosetta(DE3) strains are recommended for expression of eukaryotic proteins, with the latter being advantageous for proteins containing rare codons.

• Culture conditions:

  • Growth temperature: 37°C until induction, then lower to 16-25°C

  • Media: LB or TB supplemented with appropriate antibiotics

  • Induction: 0.1-0.5 mM IPTG at OD600 of 0.6-0.8

• Handling membrane proteins: As ND3 is a mitochondrial membrane protein, consider:

  • Using specialized E. coli strains (C41, C43) designed for membrane protein expression

  • Adding mild detergents (0.1-0.5% Triton X-100) during cell lysis

  • Including glycerol (5-10%) in buffers to stabilize the protein

Post-expression, the protein should be purified using immobilized metal affinity chromatography (IMAC) leveraging the His-tag, followed by buffer optimization to maintain stability .

How can researchers enhance the solubility and stability of recombinant ND3 protein during purification and storage?

Enhancing solubility and stability of recombinant Asterina pectinifera ND3 protein requires specific strategies addressing its hydrophobic nature:

Purification optimization:

• Use mild detergents (DDM, CHAPS, or Triton X-100) at concentrations just above their critical micelle concentration

• Include stabilizing agents such as glycerol (10-20%) and reducing agents (1-5 mM DTT or 2-mercaptoethanol)

• Optimize pH conditions (typically pH 7.4-8.0 for mitochondrial proteins)

• Consider adding specific lipids that mimic the mitochondrial membrane environment

Storage conditions:
Based on available recommendations, the purified ND3 protein should be:

• Lyophilized or stored in solution with 50% glycerol

• Aliquoted to avoid repeated freeze-thaw cycles

• Stored at -20°C or -80°C for long-term storage

• For working aliquots, store at 4°C for up to one week

For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol for long-term storage stability .

What experimental approaches are used to study the function of ND3 in mitochondrial Complex I?

Several experimental approaches can be employed to study the function of Asterina pectinifera ND3 in mitochondrial Complex I:

• Biochemical activity assays:

  • NADH:ubiquinone oxidoreductase activity assays using purified protein

  • Electron transfer rate measurements

  • Proton pumping efficiency determination using reconstituted liposomes

• Structural studies:

  • Cryo-electron microscopy for structural determination within Complex I

  • NMR studies for dynamic conformational analysis

  • Cross-linking experiments to identify protein-protein interactions

• Mutagenesis approaches:

  • Site-directed mutagenesis of conserved residues

  • Deletion mutants to identify functional domains

  • Generation of chimeric proteins with ND3 from other species to identify species-specific functional elements

• In vivo functional analysis:

  • Complementation studies in model organisms

  • Respiration measurements in reconstituted systems

  • ROS (reactive oxygen species) production assessment

These methodologies should be selected based on the specific research question and available resources. For initial characterization, SDS-PAGE analysis of the purified protein can confirm expression and molecular weight .

How can researchers investigate the role of ND3 sequence variations in adaptation to different environmental conditions?

Investigating the role of ND3 sequence variations in environmental adaptation requires a multi-disciplinary approach:

• Comparative genomic analysis:

  • Sequence alignment of ND3 from Asterina pectinifera with related species from different habitats

  • Identification of non-synonymous variations in functional domains

  • Calculation of selection pressure (dN/dS ratios) to identify positively selected sites

• Structure-function relationship studies:

  • Homology modeling of ND3 proteins from different species

  • Identification of variations in functionally important regions

  • In silico prediction of how variations might affect protein function

• Functional characterization:

  • Expression of ND3 variants from species adapted to different environments

  • Measurement of enzymatic activity under varying conditions (temperature, pH, salinity)

  • Assessment of protein stability across environmental gradients

• Environmental correlation studies:

  • Analysis of ND3 sequence variations across species from different habitats

  • Correlation of specific amino acid substitutions with environmental parameters

  • Testing hypotheses about adaptive significance through directed evolution experiments

The existing research has shown significant sequence differences between Asterina pectinifera and Acanthaster species, with notable changes in codon usage and deletions near the 3' end of the gene . These differences may reflect adaptations to differing ecological niches and metabolic requirements.

How do nucleotide composition biases in the ND3 gene compare between Asterina pectinifera and other echinoderm species?

Analysis of nucleotide composition biases in the ND3 gene reveals distinct patterns across echinoderm species:

Strand-specific nucleotide biases:
In Asterina pectinifera and Acanthaster species, a consistent strand-specific bias is observed where:

• The L strand preferentially uses A or C

• The H strand preferentially uses G or T, particularly in the third codon positions

This bias can be quantified using GC-skew and AT-skew calculations:

• GC-skew = (G-C)/(G+C)

• AT-skew = (A-T)/(A+T)

The following table illustrates comparative nucleotide composition between Asterina pectinifera and other echinoderms:

This conservation of bias pattern among asteroid species, with variations in other echinoderms, suggests evolutionary constraints that maintain these genomic features across related taxa while allowing for lineage-specific adaptations .

What evolutionary insights can be gained from comparing ND3 sequences across different starfish species?

Comparative analysis of ND3 sequences across starfish species provides valuable evolutionary insights:

• Phylogenetic relationships:

  • ND3 sequence variations can help resolve phylogenetic relationships within Asteroidea

  • The notable 18 bp difference between Asterina pectinifera and Acanthaster species indicates significant evolutionary divergence

  • Conservation patterns in specific domains suggest functional constraints

• Selection pressures:

  • Analysis of synonymous vs. non-synonymous substitutions reveals selective pressures

  • Regions with high conservation likely represent functionally critical domains

  • Variable regions may indicate adaptation to different ecological niches

• Codon usage patterns:

  • The strand-specific biases in nucleotide composition observed across asteroid species suggest shared evolutionary history

  • Divergent patterns, such as those seen in crinoids like Florometra serratissima, indicate ancient evolutionary splits

• Molecular clock estimations:

  • Rate of sequence divergence in ND3 can be used to estimate divergence times

  • Calibration with fossil records can provide absolute timing of evolutionary events

These comparative studies contribute to our understanding of echinoderm evolution, mitochondrial genome dynamics, and the adaptive significance of variations in respiratory chain components across marine invertebrates.

What are common challenges in working with recombinant ND3 protein and how can they be addressed?

Researchers working with recombinant Asterina pectinifera ND3 protein often encounter several challenges that require specific troubleshooting strategies:

• Low expression levels:

  • Challenge: Hydrophobic membrane proteins often express poorly in E. coli

  • Solution: Optimize codon usage, use specialized strains (C41/C43), lower induction temperature (16-18°C), and consider fusion partners that enhance solubility (SUMO, MBP)

• Protein aggregation:

  • Challenge: Formation of inclusion bodies during expression

  • Solution: Express at lower temperatures, reduce inducer concentration, add mild detergents during lysis, consider refolding protocols if necessary

• Purification difficulties:

  • Challenge: Maintaining protein stability during purification

  • Solution: Include appropriate detergents throughout purification, keep samples cold, minimize exposure to air, use stabilizing additives like glycerol

• Protein degradation:

  • Challenge: Rapid degradation during storage

  • Solution: Add protease inhibitors during purification, store with 50% glycerol at -80°C, avoid repeated freeze-thaw cycles

• Activity loss:

  • Challenge: Loss of functional activity after purification

  • Solution: Reconstitute in lipid bilayers or nanodiscs, verify proper folding, optimize buffer conditions

When working with His-tagged ND3, researchers should be particularly careful with imidazole concentrations during elution, as high concentrations can destabilize membrane proteins. A stepwise elution strategy with gradually increasing imidazole concentrations is recommended.

How can researchers design experiments to study the interaction of ND3 with other Complex I subunits?

Designing experiments to study interactions between Asterina pectinifera ND3 and other Complex I subunits requires specialized approaches:

• Co-immunoprecipitation and pull-down assays:

  • Express ND3 with affinity tags (His-tag ) and potential interacting partners with different tags

  • Perform pull-down experiments under native conditions using appropriate detergents

  • Analyze complexes by Western blotting or mass spectrometry

• Crosslinking studies:

  • Use chemical crosslinkers with different spacer arms to capture transient interactions

  • Identify crosslinked products by mass spectrometry

  • Experiment with photoactivatable crosslinkers for spatial precision

• Yeast two-hybrid adaptations:

  • Use split-ubiquitin or MYTH (Membrane Yeast Two-Hybrid) systems designed for membrane proteins

  • Create fusion constructs with ND3 and potential interacting partners

  • Screen for positive interactions through reporter gene activation

• Reconstitution experiments:

  • Reconstitute purified ND3 with other Complex I subunits in liposomes or nanodiscs

  • Measure assembly efficiency and functional activity of the reconstituted complex

  • Compare with native Complex I activity

• Computational approaches:

  • Perform molecular docking simulations based on available structural data

  • Use coevolution analysis to predict interacting residues

  • Validate predictions experimentally through site-directed mutagenesis

These methodologies can help elucidate the structural and functional relationships between ND3 and other Complex I components, providing insights into the assembly and regulation of this important respiratory complex.

How might recombinant ND3 contribute to understanding mitochondrial disorders in echinoderms and other organisms?

Recombinant Asterina pectinifera ND3 protein offers valuable opportunities for understanding mitochondrial disorders across species:

• Model system development:

  • Echinoderms can serve as alternative models for studying mitochondrial dysfunction

  • Comparison of ND3 function across species can highlight conserved disease mechanisms

  • The well-characterized 116-amino acid sequence of A. pectinifera ND3 provides a foundation for structure-function studies

• Pathogenic mutation analysis:

  • Introduction of mutations corresponding to human pathogenic variants in recombinant echinoderm ND3

  • Assessment of functional consequences in simplified systems

  • Screening potential therapeutic compounds using the recombinant protein as a target

• Evolutionary medicine insights:

  • Comparative analysis of ND3 across species with different lifespans and metabolic rates

  • Identification of protective mechanisms in species resistant to oxidative stress

  • Application of insights to human mitochondrial disease research

• Biomarker development:

  • Use of recombinant ND3 to generate specific antibodies for detecting ND3 modifications

  • Development of assays to measure Complex I dysfunction in various organisms

  • Application to environmental monitoring and ecotoxicology studies

The study of recombinant ND3 proteins from echinoderms may seem taxonomically distant from human medicine, but the high conservation of mitochondrial function across eukaryotes means that fundamental insights can have broad applications in understanding and potentially treating mitochondrial disorders.

What research questions remain unanswered regarding the role of ND3 in echinoderm physiology and evolution?

Despite advances in our understanding of Asterina pectinifera ND3, several important research questions remain unanswered:

• Functional adaptation:

  • How do the sequence differences between A. pectinifera and Acanthaster species (18 bp shorter in A. pectinifera) affect the functional properties of ND3?

  • Do these variations correlate with differences in metabolic rate, habitat preference, or stress tolerance?

  • What is the adaptive significance of the deletions observed near the 3' end of the ND3 gene?

• Developmental regulation:

  • How is ND3 expression regulated during development and regeneration in echinoderms?

  • Does ND3 play roles in tissue-specific mitochondrial function during the remarkable regenerative processes observed in starfish?

  • Could ND3 be connected to the regenerative capacities demonstrated in studies with Asterina coronata ?

• Environmental responses:

  • How does ND3 function respond to environmental stressors like temperature, pH, and oxygen availability?

  • Are there post-translational modifications of ND3 that regulate its activity under stress conditions?

  • Do echinoderm-specific features of ND3 contribute to their ecological success in diverse marine environments?

• Biochemical interactions:

  • Does ND3 from A. pectinifera interact with other cellular components beyond Complex I?

  • Are there echinoderm-specific interacting partners that reveal novel functions?

  • How do the nucleotide composition biases observed in mitochondrial genes affect translation efficiency and protein folding?

Addressing these questions will require interdisciplinary approaches combining molecular techniques, physiological studies, and ecological observations to fully understand the role of this protein in echinoderm biology.