Recombinant Astyanax fasciatus Blue-sensitive opsin (B23)

Shipped with Ice Packs
In Stock

Description

Biological Origin and Significance

Astyanax fasciatus exists in two distinct forms: the surface-dwelling (epigean) form with functional eyes and the cave-dwelling (hypogean) form that is blind with only subdermal eye rudiments. Despite their blindness, the cave-dwelling populations remarkably maintain intact opsin genes, including the blue-sensitive opsin (B23) . This evolutionary paradox has made Astyanax fasciatus an important model organism for studying visual system evolution, adaptation to extreme environments, and the genetic basis of regressive traits. The preservation of functional opsin genes in blind cave populations suggests potential non-visual roles for these photoreceptive proteins or represents evolutionary remnants that have not yet been eliminated by natural selection .

The blue-sensitive opsin (B23) belongs to a family of G-protein coupled receptors responsible for light detection in vertebrate photoreceptor cells. In the visual system, it specifically mediates sensitivity to blue wavelengths of light, functioning alongside other opsin types such as the green-sensitive opsin (G103) to enable color discrimination in species with functional vision .

Protein Structure

The recombinant B23 protein consists of 355 amino acids representing the full-length native protein, with an N-terminal His-tag added to facilitate purification and detection . The protein is produced in Escherichia coli expression systems, providing a consistent source of the protein for research applications .

Comparative Analysis

FeatureBlue-Sensitive Opsin (B23)Green-Sensitive Opsin-1 (G103)
UniProt IDP51472P22330
Amino Acid Length355355
Common NameBlue cone photoreceptor pigmentGreen cone photoreceptor pigment 1
Expression SystemE. coliE. coli
Recombinant TagHis (N-terminal)His (N-terminal)

The blue-sensitive opsin (B23) and green-sensitive opsin-1 (G103) share similar structural characteristics but differ in their spectral sensitivity properties . While both contain 355 amino acids, their sequence differences confer distinct wavelength absorption maxima, with B23 being sensitive to shorter (blue) wavelengths and G103 responding to medium (green) wavelengths of visible light.

Recombinant Production Methods

The recombinant B23 protein is produced using bacterial expression systems, specifically E. coli . The gene encoding the full-length protein (amino acids 1-355) is cloned into an expression vector that introduces an N-terminal histidine tag. This approach allows for efficient protein production and subsequent purification using affinity chromatography techniques.

Reconstitution Protocol

For optimal results, the product vial should be briefly centrifuged prior to opening to bring contents to the bottom . The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% and aliquot before storing at -20°C to -80°C, with 50% being the default recommendation .

Evolutionary Studies

One of the most significant applications of recombinant B23 protein is in evolutionary biology research. The Mexican blind cavefish (Astyanax fasciatus) presents a fascinating case where blind cave-dwelling populations maintain functional opsin genes despite having lost their eyes through evolution . Studies involving hybrid populations between surface and cave forms show considerable variation in visual pigments, with evidence for groups of cells with intermediate spectral sensitivity maxima . Research with recombinant B23 can help elucidate the molecular basis of these variations and provide insights into evolutionary processes affecting visual systems.

Structure-Function Relationships

Investigations into opsin structure-function relationships have demonstrated that even minor variations in opsin coding sequences can significantly affect visual function. For example, studies of human L opsin haplotypes have shown that variant opsins may form functional pigments that traffic to cell membranes but exhibit reduced stability compared to wild-type proteins . While not directly related to B23, these findings suggest similar investigations could be conducted with Astyanax opsins to understand how sequence variations affect protein stability, spectral sensitivity, and signal transduction efficiency.

Comparative Visual Physiology

The availability of recombinant B23 enables comparative studies of photopigment properties across different species and ecological adaptations. Microspectrophotometry studies of Astyanax hybrid populations have revealed evidence for ultraviolet-sensitive single cones and additional middle-wavelength-sensitive pigments . Recombinant proteins can facilitate in vitro spectral sensitivity measurements and protein interaction studies that would be difficult to perform with native proteins in their cellular context.

Experimental Design Considerations

When working with recombinant opsins like B23, researchers must consider several technical factors that may affect experimental outcomes:

  1. The recombinant protein lacks post-translational modifications that may be present in the native protein

  2. The His-tag, while useful for purification, may influence protein folding or function

  3. In vitro conditions differ significantly from the native membrane environment of opsins

Functional Reconstitution

For functional studies, opsins typically require reconstitution with the chromophore 11-cis-retinal to form photosensitive pigments. The protocols for such reconstitution must be carefully optimized to ensure proper formation of the visual pigment complex. Additionally, membrane-mimetic environments such as detergent micelles or lipid nanodiscs may be necessary to maintain protein stability and function.

Current Research and Future Directions

Research on Astyanax fasciatus opsins continues to offer valuable insights into visual system evolution and adaptation. Future directions may include:

  1. Comprehensive comparative analyses of opsin properties between surface and cave populations

  2. Investigation of potential non-visual roles of opsins in blind cave populations

  3. Application of advanced structural biology techniques to determine high-resolution structures of B23 and related opsins

  4. Exploration of potential biotechnological applications, such as the development of biosensors based on photosensitive properties of B23

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes; we will accommodate requests as possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize developing it to your specifications.
Synonyms
B23; Blue-sensitive opsin; Blue cone photoreceptor pigment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Astyanax fasciatus (Blind cave fish) (Astyanax mexicanus)
Target Names
B23
Target Protein Sequence
MKSRPQEFQEDFYIPIPLDTNNITALSPFLVPQDHLGGSGIFMIMTVFMLFLFIGGTSIN VLTIVCTVQYKKLRSHLNYILVNLAISNLLVSTVGSFTAFVSFLNRYFIFGPTACKIEGF VATLGGMVSLWSLSVVAFERWLVICKPVGNFSFKGTHAIIGCALTWFFALLASTPPLFGW SRYIPEGLQCSCGPDWYTTENKYNNESYVMFLFCFCFGFPFTVILFCYGQLLFTLKSAAK AQADSASTQKAEREVTKMVVVMVMGFLVCWLPYASFALWVVFNRGQSFDLRLGTIPSCFS KASTVYNPVIYVFMNKQFRSCMMKLIFCGKSPFGDDEEASSSSQVTQVSSVGPEK
Uniprot No.

Target Background

Function

Visual pigments are the light-absorbing molecules essential for vision. They consist of an opsin apoprotein covalently bound to cis-retinal.

Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
The color pigments are found in the cone photoreceptor cells.

Q&A

What is the Astyanax fasciatus blue-sensitive opsin (B23) and what is its significance in visual research?

The B23 blue-sensitive opsin is a photoreceptor protein from the blind cavefish (Astyanax fasciatus/mexicanus) that belongs to the family of G protein-coupled receptors responsible for color vision. It specifically detects light in the blue wavelength spectrum and transduces this information into cellular signals. This protein has the UniProt ID P51472 and consists of 355 amino acids .

The significance of B23 in visual research lies in understanding the evolution and diversification of visual systems. Astyanax mexicanus possesses multiple visual and non-visual opsins, including red-, green-, and blue-sensitive variants, which are critical for light perception, circadian regulation, and phototransduction pathways. Studying B23 provides insights into how visual systems adapt to different light environments and how gene duplication events contribute to visual diversity in vertebrates.

What are the primary applications of recombinant B23 in vision research?

Recombinant B23 protein has several important applications in vision research:

  • Spectral Sensitivity Studies: The purified protein can be used to characterize the precise spectral sensitivity profile of the blue-sensitive opsin through spectrophotometric analysis.

  • Structure-Function Relationship Analysis: By comparing B23 with other opsins, researchers can identify amino acid residues critical for wavelength specificity.

  • Evolutionary Studies: B23 serves as a model for understanding opsin gene duplication and diversification in teleost fish.

  • Antibody Generation: The recombinant protein can be used to generate specific antibodies for immunohistochemical localization of blue-sensitive opsins in retinal tissue.

  • Protein-Protein Interaction Studies: It enables investigation of interactions between opsins and other components of the phototransduction cascade.

The recombinant B23 protein is commonly used in applications such as SDS-PAGE for analyzing protein expression and purification efficiency .

How do regulatory mechanisms control the expression of B23 compared to other visual opsins in teleost fish?

The expression of visual opsins in teleost fish involves complex regulatory mechanisms that control both cell-type specificity and developmental timing. While specific regulatory elements for B23 aren't directly described in the search results, insights can be drawn from studies on other opsin genes in teleosts:

In zebrafish, duplicated red opsin genes (LWS-1 and LWS-2) are regulated by a 0.6-kb "LWS-activating region" (LAR) located upstream of the gene array . This enhancer regulates the expression of both genes in long-wavelength-sensitive double cones (LDCs). Importantly, the interaction between LAR and the promoters of these genes appears to be competitive and developmentally regulated, resulting in spatially distinct expression patterns across the retina .

For B23, similar regulatory mechanisms likely exist. The expression of B23 would need regulatory elements that determine:

  • Cell-type specificity: Ensuring expression in the appropriate photoreceptor type (likely short-wavelength-sensitive cones)

  • Temporal regulation: Controlling when during development the opsin is expressed

  • Spatial regulation: Determining the regional distribution of B23-expressing cells across the retina

These regulatory mechanisms might involve enhancer regions similar to the LAR described for red opsins, possibly containing binding sites for transcription factors like Otx/Crx, which are known to regulate photoreceptor gene expression .

For duplicated opsin genes, sharing regulatory regions appears to be a common feature that facilitates differential expression, as observed in zebrafish red and green opsins and primate L/M opsins . This mechanism could also apply to B23 if it resulted from gene duplication.

What approaches are most effective for studying spectral tuning sites in B23, and how do they compare to those identified in other blue opsins?

To study spectral tuning sites in B23, several complementary approaches can be employed:

  • Comparative Sequence Analysis: Aligning B23 with other blue opsins from related species helps identify potentially important amino acid substitutions. This approach revealed potential spectral tuning sites at positions 118, 215, and 269 in the blue opsin of cottoid fish from Lake Baikal .

  • Site-Directed Mutagenesis: This is a powerful method for directly testing the role of specific amino acids in spectral tuning. Following the approach used with the Lake Baikal cottoid fish, researchers can generate mutations at potential tuning sites in B23 through site-directed mutagenesis .

  • Heterologous Expression Systems: The mutant opsins can be expressed in cell lines such as 293T cells, followed by isolation and regeneration with chromophore to measure their spectral properties . For B23, E. coli has been successfully used as an expression system for producing recombinant protein .

  • Microspectrophotometry or Spectrophotometry: These techniques allow for precise measurement of the absorption spectrum of the regenerated pigment, enabling quantification of spectral shifts caused by specific mutations.

  • Molecular Dynamics Simulations: Computational approaches can predict how specific amino acid substitutions affect the protein structure and chromophore environment.

The effectiveness of these approaches for B23 would depend on successfully expressing functional protein that can be regenerated with chromophore. When comparing with other blue opsins, researchers should focus on known tuning sites in blue-sensitive visual pigments and examine whether B23 contains similar or unique substitutions at these positions.

How can researchers effectively distinguish between the functions of different opsin variants in Astyanax fasciatus, particularly in developmental studies?

Distinguishing between different opsin variants in Astyanax fasciatus, especially during development, requires a multi-faceted approach:

  • Gene-Specific Probes for In Situ Hybridization: Designing probes that target unique regions of each opsin transcript allows visualization of the spatial and temporal expression patterns. This technique was used effectively to show that zebrafish LWS-1 and LWS-2 have distinct developmental expression patterns, with LWS-2 expression beginning at 40 hours post-fertilization and LWS-1 expression starting later at 3.5-5.5 days post-fertilization .

  • Transgenic Reporter Assays: By replacing the first exons of opsin genes with fluorescent reporters (e.g., GFP for one opsin, RFP for another), researchers can visualize the expression of different opsins in living animals. This approach successfully recapitulated the expression patterns of zebrafish red opsins LWS-1 and LWS-2 .

  • Subtype-Specific Antibodies: Developing antibodies that specifically recognize B23 but not other opsins would allow immunohistochemical detection of the protein in tissue sections.

  • PAC Clone Modifications: Using P1 artificial chromosome (PAC) clones containing the opsin genes and their regulatory regions, researchers can create reporter constructs to study the regulation of expression. This approach was used successfully with zebrafish red opsins .

  • Regulatory Region Analysis: Identifying and characterizing the regulatory regions controlling B23 expression could reveal mechanisms of developmental regulation. For zebrafish red opsins, a 0.6-kb "LWS-activating region" (LAR) was found to regulate expression of both duplicated genes .

  • CRISPR-Cas9 Gene Editing: Creating targeted knockouts or modifications of specific opsin genes can help determine their functions through loss-of-function or gain-of-function analyses.

These approaches can be combined to comprehensively understand the developmental regulation and functional significance of B23 compared to other opsins in Astyanax fasciatus.

What are the optimal expression systems and purification methods for producing functional recombinant B23 protein?

The optimal expression systems and purification methods for producing functional recombinant B23 protein involve several important considerations:

Expression Systems:

Purification Methods:

  • Affinity Chromatography: The His-tagged B23 protein can be efficiently purified using nickel or cobalt affinity resins. This approach typically involves:

    • Cell lysis in a detergent-containing buffer (e.g., n-dodecyl-β-D-maltoside)

    • Binding to Ni-NTA or similar resin

    • Washing with increasing imidazole concentrations

    • Elution with high imidazole concentration

  • Size Exclusion Chromatography: As a secondary purification step to achieve higher purity and remove aggregates

  • Ion Exchange Chromatography: Can be used as an additional purification step based on the protein's calculated isoelectric point

Buffer Considerations:
Based on documented storage conditions for B23 , optimal buffers include:

  • Tris/PBS-based buffer, pH 8.0, containing 6% trehalose for stabilization

  • Addition of glycerol (5-50%) for long-term storage

Reconstitution with Chromophore:
For functional studies, the purified opsin must be reconstituted with a chromophore (typically 11-cis-retinal). This is a critical step that requires:

  • Working under dim red light conditions

  • Incubation with excess chromophore

  • Removal of unbound chromophore

Following the manufacturer's recommendations, the lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL and stored with glycerol at -20°C/-80°C to avoid repeated freeze-thaw cycles .

How can researchers effectively design experiments to study the evolution of B23 in relation to habitat-specific adaptations in Astyanax species?

Designing effective experiments to study the evolution of B23 in relation to habitat-specific adaptations in Astyanax species requires a comprehensive approach:

  • Comparative Genomics Approach:

    • Sequence B23 from multiple Astyanax populations occupying different habitats (surface-dwelling vs. cave-dwelling)

    • Perform phylogenetic analyses to reconstruct the evolutionary history of B23

    • Calculate selection parameters (dN/dS ratios) to identify sites under positive selection

    • Compare with other visual opsins (red, green) from the same populations to identify opsin-specific patterns

  • Structure-Function Analysis:

    • Identify amino acid substitutions between surface and cave populations

    • Use site-directed mutagenesis to recreate these substitutions in recombinant proteins

    • Express and purify the variant proteins

    • Measure spectral sensitivity differences using spectrophotometry

    • Correlate spectral shifts with specific habitat light conditions

  • Expression Pattern Analysis:

    • Develop methods to quantify B23 expression levels across different Astyanax populations

    • Use quantitative PCR, RNA-seq, or in situ hybridization

    • Compare expression patterns between surface-dwelling and cave-dwelling populations

    • Correlate expression differences with environmental factors (light availability, spectrum)

  • Regulatory Region Analysis:

    • Sequence and compare B23 regulatory regions between populations

    • Use reporter assays to identify functional differences in gene regulation

    • Test the hypothesis that shared regulatory regions may facilitate opsin expression differentiation, as observed in zebrafish red opsins

  • Functional Ecology Experiments:

    • Design behavioral assays to test visual capabilities related to B23 function

    • Compare visual behaviors between populations

    • Correlate visual performance with B23 sequence variants or expression levels

  • Developmental Studies:

    • Examine B23 expression during development in different populations

    • Test whether developmental timing differences correlate with habitat adaptation

    • Compare with known developmental patterns, such as those observed in zebrafish where LWS-1 expression occurs later than LWS-2

This multi-faceted approach would provide a comprehensive understanding of how B23 has evolved in response to different light environments in Astyanax species, particularly between surface-dwelling and cave-dwelling populations.

What are the most reliable methods for characterizing the spectral sensitivity of recombinant B23 protein, and what technical challenges might researchers encounter?

Characterizing the spectral sensitivity of recombinant B23 protein requires sophisticated biophysical approaches, each with specific advantages and technical challenges:

Primary Methods for Spectral Characterization:

  • UV-Visible Absorption Spectroscopy:

    • Method: Purified B23 is reconstituted with 11-cis-retinal and absorption spectra are measured across wavelengths (typically 250-650 nm)

    • Advantages: Direct measurement of absorbance maximum (λmax)

    • Challenges: Requires highly purified protein in sufficient quantity; chromophore instability under light; potential for protein denaturation during purification

  • Fluorescence Spectroscopy:

    • Method: Measures changes in intrinsic tryptophan fluorescence upon chromophore binding or light activation

    • Advantages: Higher sensitivity than absorption spectroscopy

    • Challenges: Indirect measurement; potential interference from other fluorophores

  • Electrophysiological Techniques:

    • Method: Patch-clamp recording from cells expressing B23 and appropriate G-protein signaling components

    • Advantages: Measures functional response to light of different wavelengths

    • Challenges: Requires expression of multiple proteins; technical complexity

  • Calcium Imaging:

    • Method: Measures light-induced calcium changes in cells co-expressing B23 and appropriate signaling components

    • Advantages: Allows high-throughput screening of multiple variants

    • Challenges: Indirect measurement; requires co-expression of signaling components

Technical Challenges and Solutions:

  • Protein Stability Issues:

    • Challenge: Membrane proteins like opsins are often unstable when removed from the membrane environment

    • Solution: Use mild detergents (DDM, LMNG); add lipids during purification; consider nanodiscs or liposome reconstitution

  • Chromophore Handling:

    • Challenge: 11-cis-retinal is light-sensitive and can isomerize

    • Solution: Work under dim red light; use fresh chromophore; consider more stable analogs for initial studies

  • Expression Levels:

    • Challenge: Obtaining sufficient functional protein for spectroscopic analysis

    • Solution: Optimize codon usage; use stronger promoters; screen multiple expression systems

  • Proper Folding:

    • Challenge: Ensuring recombinant B23 adopts native conformation

    • Solution: Consider eukaryotic expression systems; optimize temperature during expression; use molecular chaperones

  • Differentiating Spectral Shifts:

    • Challenge: Determining whether spectral differences are due to protein changes or experimental conditions

    • Solution: Include control proteins with known spectral properties; standardize all experimental conditions

  • Data Interpretation:

    • Challenge: Fitting spectral curves to extract accurate λmax values

    • Solution: Use multiple curve-fitting approaches; account for multiple spectral states that may exist

These methodological considerations are crucial for researchers working with B23 to obtain reliable spectral characterization data that can inform our understanding of blue light sensitivity in Astyanax fasciatus.

What are the most significant unresolved questions about B23 that warrant further investigation?

Despite the available information on the Astyanax fasciatus blue-sensitive opsin (B23), several significant questions remain unresolved and warrant further investigation:

  • Evolutionary Origin: How did B23 evolve in the Astyanax lineage, and what selective pressures drove its spectral tuning? Comparative genomic analyses across related species could help reconstruct the evolutionary history of this opsin.

  • Regulatory Mechanisms: What are the specific regulatory elements controlling B23 expression, and how do they compare to those identified for other opsins like the zebrafish LWS-activating region (LAR) ? Understanding these mechanisms would provide insights into how visual systems are fine-tuned through differential gene expression.

  • Functional Role in Cave Populations: Given that some Astyanax populations live in completely dark cave environments, what has happened to B23 expression and function in these populations? Has the gene been pseudogenized or repurposed?

  • Precise Spectral Tuning Mechanisms: Which specific amino acid residues are responsible for the blue sensitivity of B23, and how do they compare to the spectral tuning sites identified in other blue opsins, such as those at positions 118, 215, and 269 in cottoid fish ?

  • Interaction with Signaling Partners: How does B23 interact with specific G-proteins and other downstream signaling components? Do these interactions differ from those of other opsins in ways that might affect signal transduction?

  • Developmental Regulation: How is B23 expression regulated during development, and how does this compare to the developmentally controlled expression of other opsins such as the zebrafish red opsins ?

  • Non-Visual Functions: Does B23 have any roles outside the classical visual pathway, such as in circadian rhythm regulation or other light-dependent processes?

  • Structural Determinants of Stability: What structural features determine the stability and folding efficiency of B23, and how might these be engineered to improve recombinant expression?

Addressing these questions would significantly advance our understanding of visual system evolution, adaptation, and function, with potential implications for broader questions in sensory biology and protein engineering.

How might knowledge gained from studying B23 contribute to broader understanding of visual system evolution and adaptation?

Knowledge gained from studying the B23 blue-sensitive opsin contributes significantly to our broader understanding of visual system evolution and adaptation in several ways:

  • Mechanisms of Spectral Tuning: By identifying the specific amino acid substitutions that confer blue sensitivity to B23, researchers can better understand the molecular basis of spectral tuning across diverse visual systems. This knowledge can be applied to predict spectral properties of opsins in other species and understand how visual pigments adapt to different light environments.

  • Gene Duplication and Functional Diversification: The study of B23 alongside other opsins in Astyanax fasciatus provides insights into how gene duplication events lead to functional diversification. The patterns observed in fish visual opsin evolution can inform our understanding of similar processes in other sensory systems and gene families.

  • Regulatory Evolution: Investigating how B23 expression is regulated can reveal mechanisms of regulatory evolution that apply more broadly. The zebrafish studies showing how duplicated red opsins share regulatory regions demonstrates how gene expression can be differentially controlled following duplication , a principle that likely extends to many gene families.

  • Adaptation to Extreme Environments: Astyanax fasciatus exists in both surface and cave environments, making it an excellent model for studying how visual systems adapt to extreme conditions. The fate of B23 in cave populations (whether pseudogenization, repurposing, or maintenance) provides insights into how sensory systems evolve under relaxed or altered selection pressures.

  • Developmental Regulation of Sensory Systems: Understanding how B23 expression is regulated during development contributes to our knowledge of how complex sensory systems are assembled. The zebrafish studies showing spatiotemporal regulation of opsin expression reveal mechanisms that likely apply across vertebrate visual systems.

  • Structure-Function Relationships in G-Protein Coupled Receptors: As a member of the G-protein coupled receptor (GPCR) superfamily, insights from B23 structure-function studies can inform our understanding of this important class of signaling proteins more broadly, with potential applications in drug design and protein engineering.

  • Comparative Visual Ecology: By correlating B23 properties with the light environment and visual ecology of Astyanax fasciatus, researchers can better understand how molecular adaptations translate to ecological function, a principle that extends across sensory biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.