Recombinant Astyanax fasciatus Green-sensitive opsin-1 (G103)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate special requests. If you have a specific format requirement, please indicate it when placing your order, and we will prepare the product accordingly.
Note: While we preferentially ship the format we have in stock, we are happy to accommodate special requests. If you have a specific format requirement, please indicate it when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life depends on factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
G103; GF; Green-sensitive opsin-1; Green cone photoreceptor pigment 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-355
Protein Length
full length protein
Species
Astyanax fasciatus (Blind cave fish) (Astyanax mexicanus)
Target Names
G103
Target Protein Sequence
MAAHADEPVFAARRYNEETTRESAFVYTNANNTRDPFEGPNYHIAPRWVYNLASLWMIIV
VIASIFTNSLVIVATAKFKKLRHPLNWILVNLAIADLGETVLASTISVFNQVFGYFVLGH
PMCIFEGWTVSVCGITALWSLTIISWERWVVVCKPFGNVKFDGKWAAGGIIFAWTWAIIW
CTPPIFGWSRYWPHGLKTSCGPDVFSGSEDPGVASYMVTLLLTCCILPLSVIIICYIFVW
NAIHQVAQQQKDSESTQKAEKEVSRMVVVMILAFILCWGPYASFATFSALNPGYAWHPLA
AALPAYFAKSATIYNPIIYVFMNRQFRSCIMQLFGKKVEDASEVSGSTTEVSTAS
Uniprot No.
Target Background
Function
Visual pigments are the light-absorbing molecules responsible for mediating vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
The color pigments are found in the cone photoreceptor cells.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
