Recombinant Astyanax fasciatus Green-sensitive opsin-2 (G101)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
G101; Green-sensitive opsin-2; Green cone photoreceptor pigment 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Astyanax fasciatus (Blind cave fish) (Astyanax mexicanus)
Target Names
G101
Target Protein Sequence
MAAHEPVFAARRHNEDTTRESAFVYTNANNTRDPFEGPNYHIAPRWVYNVSSLWMIFVVI ASVFTNGLVIVATAKFKKLRHPLNWILVNLAIADLGETVLASTISVINQIFGYFILGHPM CVFEGWTVSVCGITALWSLTIISWERWVVVCKPFGNVKFDGKWAAGGIIFSWVWAIIWCT PPIFGWSRYWPHGLKTSCGPDVFSGSEDPGVASYMITLMLTCCILPLSIIIICYIFVWSA IHQVAQQQKDSESTQKAEKEVSRMVVVMILAFIVCWGPYASFATFSAVNPGYAWHPLAAA MPAYFAKSATIYNPIIYVFMNRQFRSCIMQLFGKKVEDASEVSGSTTEVSTAS
Uniprot No.

Target Background

Function
Visual pigments are the light-absorbing molecules responsible for vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
The color pigments are found in the cone photoreceptor cells.

Q&A

Basic Research Questions

  • What is the genomic context of Green-sensitive opsin-2 in Astyanax fasciatus?

Astyanax fasciatus (also referred to as Astyanax mexicanus in recent literature) possesses multiple opsin genes within its genome. Based on conservative criteria, researchers have identified 33 opsin genes in the cavefish genome . The Green-sensitive opsin-2 belongs to the long-wavelength green (LG) class of opsins, with at least two LG gene sequences identified in the hypogean (cave-dwelling) genome . These genes are part of the same evolutionary class as human opsin genes .

Green-sensitive opsin genes in Astyanax contain key amino acid residues at tuning sites that affect spectral sensitivity. The three major tuning sites in LG pigments are position 180 in helix IV and positions 277 and 285 in helix VI, which in standard LG pigments are occupied by alanine, phenylalanine, and alanine respectively .

  • How does expression of Green-sensitive opsin-2 differ between surface and cave morphs?

Expression patterns of opsins differ significantly between surface-dwelling (epigean) and cave-dwelling (hypogean) Astyanax. Surveys of available RNAseq data found that 26 opsins were expressed in the surface fish eye compared to 24 expressed in cavefish extraocular tissues, 20 of which were expressed in the brain .

  • What methods are most effective for characterizing the spectral properties of recombinant Green-sensitive opsin-2?

Microspectrophotometry has been effectively used to characterize the spectral properties of visual pigments in Astyanax . This technique allows measurement of absorbance spectra from individual photoreceptor cells and can determine the maximal absorption wavelength (λmax) of photopigments.

For recombinant Green-sensitive opsin-2, a methodological approach would include:

  • Heterologous expression in an appropriate expression system

  • Protein purification with detergent solubilization

  • Reconstitution with either 11-cis-retinal (A1 chromophore) or 3,4-dehydroretinal (A2 chromophore)

  • Spectroscopic analysis to determine absorption characteristics

Studies on Astyanax visual pigments have shown that the λmax can vary depending on the chromophore composition, with A1/A2 pigment pairs showing values of approximately 536/567 nm for shorter-wave green pigments .

Advanced Research Questions

  • How do chromophore interactions affect the spectral tuning of Green-sensitive opsin-2?

The spectral sensitivity of Green-sensitive opsin-2 is significantly influenced by the type of chromophore bound to the opsin protein. Research on Astyanax visual pigments has demonstrated that variability in the λmax of cone photoreceptors, particularly noticeable in longer-wave pigments, results from variable mixtures of A1 (11-cis-retinal) and A2 (3,4-dehydroretinal) chromophores .

Individual fish from the epigean (surface-dwelling) population tended to fall into two groups possessing cones with either 20% or 70% A1 chromophore . From these ratios, researchers estimated the λmax of the two A1/A2 pigment pairs to be approximately 536/567 nm for the shorter-wave and 563/606 nm for the longer-wave pigments .

Chromophore Ratioλmax of Shorter-wave Green Pigmentλmax of Longer-wave Green/Red Pigment
100% A1~536 nm~563 nm
100% A2~567 nm~606 nm
70% A1 / 30% A2IntermediateIntermediate
20% A1 / 80% A2IntermediateIntermediate

The specific binding pocket residues of Green-sensitive opsin-2 would determine its interaction with these chromophores and subsequently affect its spectral properties.

  • How can site-directed mutagenesis be utilized to investigate spectral tuning mechanisms in Green-sensitive opsin-2?

Site-directed mutagenesis provides a powerful approach to investigating the spectral tuning mechanisms of Green-sensitive opsin-2. Based on identified tuning sites in LG pigments, a methodological approach would include:

  • Target the three major tuning sites: position 180 in helix IV and positions 277 and 285 in helix VI

  • Create single, double, and triple mutants at these positions

  • Express and purify the mutant proteins

  • Reconstitute with appropriate chromophores

  • Perform spectroscopic analysis to determine shifts in λmax

The search results indicate that site 180 is coded for in exon 3, while sites 277 and 285 are coded together in exon 5 . This genomic arrangement creates potential for hybrid genes composed of mixtures of exons from different opsin genes, resulting in intermediate spectral sensitivities.

  • What is the relationship between opsin expression and light-dependent behaviors in Astyanax fasciatus?

Despite having regressed eyes, cave-dwelling Astyanax still respond to light, exhibiting light-dependent locomotor activity . This suggests that non-visual photoreception, potentially mediated by opsins including Green-sensitive opsin-2, remains functional.

Research has shown that these light-dependent responses may be either evolutionary residuals or adaptive features, where negative phototaxis provides avoidance of predator-rich surface environments . The light-dependent activity shift emerges as early as 21 days post-fertilization (juvenile stage) .

Interestingly, despite the pineal organ showing high opsin expression in cavefish, pinealectomy experiments demonstrated that both pinealectomized surface fish and cavefish retained the light-dependent activity shift . This indicates that the light-dependent activity is regulated by a non-visual, non-pineal, extraocular light-sensing tissue .

  • What strategies can optimize RT-qPCR for quantifying Green-sensitive opsin-2 expression?

RT-qPCR optimization for Green-sensitive opsin-2 quantification requires careful consideration of several methodological factors:

  • Design specific primers that can distinguish between closely related opsin genes

  • Select appropriate reference genes for normalization across different tissues

  • Include tissue-specific controls based on known expression patterns

  • Optimize annealing temperatures to ensure specificity

  • Validate primer efficiency using standard curves

The search results describe using RT-qPCR to quantify expression levels for a representative set of opsin genes in the eyes and four brain regions of surface and cavefish . This approach successfully identified the pineal as the highest opsin-expressing tissue in cavefish .

When designing experiments, researchers should consider that 26 opsins were found expressed in the surface fish eye, with 20 of these expressed in the cavefish brain according to transcriptomic analyses .

Methodological Questions

  • How can researchers distinguish between genuine opsin coexpression and other phenomena in Astyanax photoreceptors?

Distinguishing between true opsin coexpression and other phenomena presents significant methodological challenges. In Astyanax hybrids, photoreceptors with intermediate spectral sensitivities could potentially be explained by:

  • Coexpression of two distinct opsin proteins in a single photoreceptor

  • Expression of hybrid opsin genes resulting from genetic recombination

  • Opsin polymorphism due to genetic drift in blind cave populations

  • Variable chromophore (A1/A2) ratios affecting spectral properties

Methodological approaches to resolve this question include:

  • Single-cell RNA sequencing of individual photoreceptors

  • In situ hybridization with opsin-specific probes

  • Immunohistochemistry with antibodies specific to each opsin variant

  • Correlative analysis of spectral sensitivity and genetic makeup of individual cells

  • What approaches are most effective for studying opsin evolution in blind cave populations?

Studying opsin evolution in blind cave populations requires a multi-faceted methodological approach:

  • Comparative genomics across surface and multiple cave populations

  • Assessment of selective pressures using dN/dS ratio analysis

  • Identification of functionally significant mutations at known tuning sites

  • Functional characterization of ancestral and derived opsin variants

  • Analysis of regulatory regions affecting expression patterns

Despite this, cave-dwelling Astyanax maintain intact opsin genes and expression in extraocular tissues, suggesting potential non-visual functions under continued selection .

  • How does the photoreceptor organization differ between surface fish and cave-surface hybrids?

The photoreceptor organization shows marked differences between surface fish and cave-surface hybrids, with implications for functional studies of opsins including Green-sensitive opsin-2.

In surface fish, cone photoreceptors are arranged in a regular square mosaic pattern, with each unit consisting of four double cones surrounding a central single cone . In contrast, hybrid fish (offspring from crosses between surface and cave forms) show considerable variation in photoreceptor organization:

  • Some hybrids display a row mosaic with many triple cones

  • Others show highly disorganized and sparse cone distribution

  • Some exhibit intermediate cone organization with partial regular arrays

These differences in photoreceptor organization are visualized in semi-thin sections through retinae as shown in the original research:

Fish TypePhotoreceptor OrganizationDistinctive Features
Surface (epigean)Regular square mosaicFour double cones around central single cone
Hybrid Type 1Row mosaicPresence of triple cones
Hybrid Type 2DisorganizedSparse cone distribution, irregular arrangement
Hybrid Type 3IntermediateRegular single cone array but degenerate double cones

These organizational differences likely affect the functional properties of photoreceptors expressing Green-sensitive opsin-2 and other visual pigments .

  • What genomic and transcriptomic approaches are most effective for characterizing opsin gene families in Astyanax?

Comprehensive characterization of opsin gene families in Astyanax requires sophisticated genomic and transcriptomic approaches:

  • Genome mining: Researchers identified 33 opsin genes in the cavefish genome using consensus sequences generated from related fish species (zebrafish, tilapia, and medaka) as queries .

  • Transcriptome analysis: RNA-Seq data from various developmental stages and tissues was searched using NCBI BLASTn and MegaBLASTn to identify expressed opsin genes .

  • Coverage assessment: For individual tissue transcriptomes, researchers visually analyzed whether the aligned 100 bp fragments covered the entire queried cDNA (993–5,052 bp in length depending on opsin genes) .

  • Expression confirmation: More than two-thirds coverage of queried cDNA by 100 bp SRA sequences (each showing 100% identity in alignments) was considered a positive hit .

A methodological workflow for opsin characterization might include:

  • Initial genome mining using consensus sequences from related species

  • Confirmation of gene structure through transcript analysis

  • Expression profiling across tissues and developmental stages

  • Functional classification based on sequence homology and expression patterns

  • How can researchers functionally characterize the non-visual roles of Green-sensitive opsin-2 in cavefish?

Functionally characterizing the non-visual roles of Green-sensitive opsin-2 in cavefish presents unique methodological challenges that require creative experimental approaches:

  • Tissue-specific knockdown or knockout: Using CRISPR-Cas9 or morpholinos to target Green-sensitive opsin-2 in specific extraocular tissues.

  • Behavioral assays: Assess light-dependent behaviors in modified and control fish, similar to the light-dependent locomotor activity experiments described in the research .

  • Calcium imaging: Detect light-induced signaling in non-visual tissues expressing Green-sensitive opsin-2.

  • Electrophysiology: Record electrical responses to light stimulation in extraocular tissues.

  • Optogenetics: Use light-sensitive channels to determine if activating the same pathways as Green-sensitive opsin-2 produces similar physiological responses.

The search results indicate that despite pinealectomy, cavefish retained light-dependent activity shifts, suggesting that Green-sensitive opsin-2 and other opsins in non-pineal extraocular tissues may play important roles in non-visual photoreception .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.