Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: Our proteins are standardly shipped with blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be finalized during production. If you have a preferred tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
R007; Red-sensitive opsin; Red cone photoreceptor pigment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Protein Length
full length protein
Species
Astyanax fasciatus (Blind cave fish) (Astyanax mexicanus)
Target Protein Sequence
MGDQWGDAVFAARRRGDDTTREAAFTYTNSNNTKDPFEGPNYHIAPRWVYNLATCWMFFV
VVASTVTNGLVLVASAKFKKLRHPLNWILVNLAIADLLETLLASTISVCNQFFGYFILGH
PMCVFEGFTVATCGIAGLWSLTVISWERWVVVCKPFGNVKFDGKMATAGIVFTWVWSAVW
CAPPIFGWSRYWPHGLKTSCGPDVFSGSEDPGVQSYMIVLMITCCFIPLGIIILCYIAVW
WAIRTVAQQQKDSESTQKAEKEVSRMVVVMIMAYCFCWGPYTFFACFAAANPGYAFHPLA
AAMPAYFAKSATIYNPVIYVFMNRQFRVCIMQLFGKKVDDGSEVSTSKTEVSSVAPA