Recombinant Ateles paniscus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Ateles paniscus MC1R is a full-length, His-tagged protein produced in E. coli for biochemical and pharmacological studies. It mirrors the native receptor’s structure, enabling research into melanocortin signaling pathways and species-specific adaptations .

Key Production Parameters

ParameterDescription
Host SystemEscherichia coli (E. coli)
TagN-terminal His tag
Protein LengthFull-length (exact length unspecified; homologous MC1Rs span ~310–317 aa)
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer

Functional Significance

  • Ligand Binding: MC1R binds α-MSH (agonist) and Agouti Signaling Protein (ASP, antagonist), modulating cAMP production and melanocyte proliferation .

  • Pigmentation Regulation:

    • Eumelanin (dark pigment) synthesis is upregulated via cAMP/PKA signaling .

    • Pheomelanin (light pigment) dominates when ASP antagonizes MC1R .

  • Environmental Adaptation: In Phrynocephalus theobaldi, high-elevation populations exhibit lighter pigmentation due to MC1R variants with reduced cAMP activity, likely an adaptation to lower UV exposure .

Research Applications

Recombinant Ateles paniscus MC1R enables:

  • Comparative Studies: Evolutionary analysis of MC1R across primates (e.g., Erythrocebus patas and Leontopithecus chrysomelas) .

  • Functional Assays: Testing receptor activation kinetics, ligand specificity, and signaling efficiency .

  • Pharmacological Screening: Identifying agonists/antagonists for therapeutic use in pigmentation disorders or melanoma .

Evolutionary and Taxonomic Context

  • Ateles paniscus (Red-faced Black Spider Monkey) belongs to the Atelidae family, inhabiting Neotropical rainforests .

  • Genetic studies reveal MC1R polymorphisms correlate with pigmentation diversity in primates, though direct data on A. paniscus variants remain limited .

Outstanding Questions

  • How do A. paniscus MC1R polymorphisms compare to human or lizard variants in structure-function relationships?

  • Does MC1R in A. paniscus show unique ligand-binding properties compared to other New World primates?

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference when placing the order, and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Ateles paniscus (Black spider monkey) (Red-faced black spider monkey)
Target Names
Target Protein Sequence
MPMQGAQKRLLGSLNSTPTATPNLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYCFICCLALSDLLVSSSNMLETAVILLLEAGALATRASVVQQLQNTI DVLTCSSMLCSLCFLGAIAVDRHVSIFYALRYHSIMTLARARRAIAAIWVASVLSSTLFI AYCDHAXVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGITRLHQRQPPAHQGFGFRGA ATLTILLGIFFLCWGPFFLHLTLVVLCPQHLTCSCIFKNFKVFLTLIICSTIIDPLIYAF RSQELRRTLKELLLCSW
Uniprot No.

Target Background

Function
This receptor serves as a binding site for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. It plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling within melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Melanocyte-stimulating hormone receptor (MC1R) and what is its primary function?

The Melanocyte-stimulating hormone receptor (MC1R), also known as MSH-R or Melanocortin receptor 1 (MC1-R), is a G-protein coupled receptor that belongs to the G-protein coupled receptor 1 family. It functions primarily as a receptor for melanocyte-stimulating hormones (α-MSH, β-MSH, and γ-MSH) and adrenocorticotropic hormone (ACTH) . The primary function of MC1R is mediating melanogenesis, which is the production of eumelanin (black/brown pigment) and phaeomelanin (red/yellow pigment) through the regulation of cAMP signaling pathways in melanocytes .

The receptor's activity is primarily mediated by G proteins that activate adenylate cyclase, resulting in increased intracellular cAMP levels . This elevation in cAMP subsequently initiates various downstream signaling cascades that ultimately regulate pigmentation processes. The MC1R is therefore central to understanding mechanisms of melanin production and pigmentation biology across different species.

What expression systems are commonly used for producing recombinant MC1R proteins?

Several expression systems are employed for the production of recombinant MC1R proteins, each with distinct advantages depending on research requirements:

  • Bacterial Expression Systems: E. coli expression systems are commonly used for producing recombinant Ateles paniscus MC1R protein . These systems offer high yield and cost-effectiveness but may present challenges for proper folding of transmembrane proteins.

  • Plant-Based Systems: Wheat germ expression systems have been successfully employed for producing human MC1R . These systems often preserve protein folding better than bacterial systems for mammalian proteins.

  • Mammalian Cell Lines: Though not explicitly mentioned in the search results, mammalian expression systems are frequently used for G-protein coupled receptors when post-translational modifications and proper membrane insertion are critical.

  • Insect Cell Systems: Baculovirus-infected insect cells represent another common approach for expressing functional GPCRs including melanocortin receptors.

The choice of expression system depends on the intended application, with bacterial systems typically preferred for structural studies requiring large quantities, while mammalian or insect cell systems are superior when functional activity of the receptor is paramount. Each system requires optimization of expression conditions, purification protocols, and validation of proper folding and function.

How can recombinant MC1R be used to study cAMP signaling pathways in melanocytes?

Recombinant MC1R serves as a powerful tool for investigating cAMP signaling pathways in melanocytes through several methodological approaches:

  • Receptor Activation Studies: Recombinant MC1R can be used to study the activation of cAMP pathways upon ligand binding. When MC1R binds its ligands (MSH or ACTH), it activates G proteins that subsequently stimulate adenylate cyclase, leading to increased intracellular cAMP levels . This elevation in cAMP can be measured using ELISA-based assays or real-time fluorescent reporters.

  • Transcriptional Regulation Analysis: As demonstrated in studies with microphthalmia gene expression, cAMP elevated by MC1R activation leads to transcriptional changes through cAMP response elements (CRE) . Recombinant MC1R can be used in reporter assays where a luciferase gene is placed downstream of a CRE-containing promoter to measure transcriptional activation in response to receptor stimulation.

  • Pathway Identification: Studies have shown that cAMP-elevating agents, including α-MSH (which acts through MC1R), upregulate microphthalmia gene expression through classical CRE that is functional specifically in melanocytes . Researchers can use recombinant MC1R to identify tissue-specific components of this pathway.

  • Temporal Dynamics Analysis: By using recombinant MC1R in time-course experiments, researchers can investigate the temporal dynamics of cAMP signaling. Studies have shown that cAMP elevation leads to a rapid but transient increase in microphthalmia protein levels, with maximal effects observed between 3-5 hours after stimulation .

These approaches collectively enable detailed characterization of the cAMP signaling cascade initiated by MC1R activation and its effects on downstream targets involved in melanogenesis.

What are the methodological considerations for studying MC1R-mediated melanogenesis in vitro?

When designing experiments to study MC1R-mediated melanogenesis in vitro, researchers should address several critical methodological considerations:

  • Cell System Selection:

    • B16 melanoma cells and normal human melanocytes have both been demonstrated as suitable models for studying melanogenesis

    • Each cell type may exhibit different baseline expression levels of MC1R and melanogenic enzymes

    • Non-melanocytic cells transfected with MC1R may lack essential downstream components of the melanogenic pathway

  • Receptor Activation Approaches:

    • Forskolin (Fsk) can be used as a direct activator of adenylate cyclase, bypassing receptor activation

    • α-MSH provides physiologically relevant receptor-mediated activation

    • Expression vectors encoding catalytic subunit of PKA can be used to directly activate downstream pathways

  • Temporal Considerations:

    • Microphthalmia expression shows time-dependent changes, with peak expression between 3-5 hours after stimulation

    • Melanin production occurs over longer timeframes (24-72 hours)

    • Experimental duration should be carefully considered based on whether examining early signaling events or end-product formation

  • Detection Methods:

    • Western blotting with monoclonal antibodies is preferable for detecting microphthalmia protein

    • Immunofluorescence can be used to assess nuclear localization of transcription factors

    • Northern blotting or qPCR can quantify changes in mRNA levels

    • Luciferase reporter assays provide quantitative assessment of promoter activity

  • Control Conditions:

    • Include both negative controls (vehicle treatment) and positive controls (direct pathway activators)

    • Consider testing multiple concentrations of stimulatory agents

    • Include time-matched controls for all experimental timepoints

By addressing these methodological considerations, researchers can design robust experiments that accurately assess MC1R-mediated melanogenesis while controlling for experimental variability.

How do signaling mechanisms differ between primate MC1R variants and what are the implications for comparative research?

Comparative analysis of MC1R signaling mechanisms across primate species reveals important evolutionary adaptations in pigmentation control systems:

  • Sequence Variation Analysis:
    Comparing the Ateles paniscus (Black spider monkey) MC1R sequence with human MC1R reveals both conserved and variable regions . The key differences include:

    RegionConservation LevelFunctional Implication
    Transmembrane domainsHigh conservationPreserved structural integrity
    G-protein binding sitesMostly conservedSimilar signaling capacity
    Ligand binding domainsModerate variationSpecies-specific ligand affinities
    N-terminal regionHigher variationPotential differences in receptor processing
  • Signaling Pathway Comparison:
    While the core signaling mechanism (G-protein activation of adenylate cyclase) appears conserved across primates , species-specific differences may exist in:

    • Ligand binding affinities

    • G-protein coupling efficiency

    • Desensitization and internalization kinetics

    • Interactions with melanocortin receptor accessory proteins

  • Downstream Effector Variations:
    Research suggests that while the cAMP-dependent activation of microphthalmia transcription factor appears conserved , species differences may exist in:

    • CRE sequence variations in target gene promoters

    • Cofactor availability and interactions (such as CBP/p300)

    • Transcriptional regulation of melanogenic enzymes

  • Implications for Comparative Research:
    These differences highlight important considerations for researchers:

    • Findings from one species may not directly translate to another

    • Comparative studies should control for species-specific receptor properties

    • Recombinant proteins from different species enable direct comparative analyses

    • Understanding evolutionary adaptations in MC1R signaling provides insights into primate adaptation to different environments and UV exposure levels

By incorporating these considerations into experimental design, researchers can leverage primate MC1R variants as evolutionary models to understand the functional evolution of pigmentation control mechanisms.

What are the optimal storage and handling conditions for recombinant MC1R proteins?

Proper storage and handling of recombinant MC1R proteins are critical for maintaining structural integrity and functional activity. Based on standard practices for transmembrane proteins and specific recommendations for MC1R:

  • Storage Conditions:

    • Store lyophilized recombinant MC1R at -20°C to -80°C for long-term storage

    • For liquid formulations, storage at -20°C/-80°C is recommended with a typical shelf life of approximately 6 months

    • Lyophilized formulations generally maintain stability longer, with a shelf life of approximately 12 months at -20°C/-80°C

  • Buffer Composition:

    • Optimal buffer systems include Tris/PBS-based buffers (pH 8.0) with cryoprotectants such as 6% Trehalose

    • For functional studies, consider buffers that preserve native conformational states of the receptor

  • Handling Practices:

    • Avoid repeated freeze-thaw cycles which can significantly degrade protein quality

    • Upon receipt, aliquot the protein into single-use volumes to minimize freeze-thaw cycles

    • Thaw frozen aliquots on ice rather than at room temperature

    • For transmembrane proteins like MC1R, gentle handling is essential to prevent aggregation

  • Reconstitution of Lyophilized Protein:

    • Use appropriate buffer systems as recommended by the manufacturer

    • Allow complete solubilization before use in experimental applications

    • Filter sterilize if necessary for cell-based applications

  • Quality Control:

    • Periodically verify protein integrity by SDS-PAGE

    • For functional studies, validate activity through ligand binding or signaling assays

    • Consider using fresh preparations for critical experiments

Following these guidelines will help maintain the quality and consistency of recombinant MC1R preparations for research applications.

What techniques are most effective for studying MC1R interactions with G-proteins and downstream signaling molecules?

Multiple complementary techniques can be employed to investigate MC1R interactions with G-proteins and downstream signaling molecules:

  • Receptor-G Protein Coupling Assays:

    • [³⁵S]GTPγS Binding Assay: Measures the exchange of GDP for GTP upon receptor activation

    • BRET/FRET-based Approaches: Allow real-time monitoring of receptor-G protein interactions in living cells

    • Co-immunoprecipitation: Detects physical interactions between MC1R and specific G-protein subunits

  • cAMP Signaling Detection:

    • ELISA-based cAMP Assays: Quantify intracellular cAMP levels following receptor stimulation

    • FRET-based Biosensors: Enable real-time visualization of cAMP dynamics within specific cellular compartments

    • CRE-Luciferase Reporter Assays: Measure transcriptional outcomes of cAMP signaling pathways

  • Downstream Pathway Analysis:

    • Western Blotting: Detect activation (phosphorylation) of downstream effectors such as microphthalmia transcription factor

    • Immunofluorescence: Visualize nuclear translocation of transcription factors following pathway activation

    • qPCR: Measure changes in target gene expression following receptor activation

  • Pharmacological Approaches:

    • Use of specific G-protein inhibitors to delineate pathway components

    • Comparison of multiple agonists (α-MSH, β-MSH, ACTH) to identify ligand-specific signaling biases

    • Forskolin as a control to directly activate adenylate cyclase, bypassing receptor-G protein coupling

  • Structural Biology Techniques:

    • Molecular Modeling: Predict interaction interfaces between MC1R and G-proteins

    • Cryo-EM: Potentially resolve complex structures of MC1R with G-proteins

    • Mutagenesis Studies: Identify key residues involved in G-protein coupling

These methodologies collectively provide a comprehensive toolkit for dissecting the molecular details of MC1R signaling from initial G-protein coupling through to transcriptional regulation of melanogenic genes.

What common challenges arise when working with recombinant MC1R and how can they be addressed?

Working with recombinant MC1R presents several technical challenges that researchers should anticipate and address:

  • Protein Solubility and Aggregation Issues:

    • Challenge: As a transmembrane protein, MC1R has hydrophobic domains prone to aggregation.

    • Solution: Use appropriate detergents or lipid reconstitution methods. Consider fusion tags that enhance solubility such as MBP or SUMO. Optimize buffer conditions with stabilizing agents like glycerol or specific lipids.

  • Maintaining Functional Conformation:

    • Challenge: Ensuring the recombinant protein retains native structure and function.

    • Solution: Validate receptor function through ligand binding assays or functional readouts (cAMP production). Compare multiple expression systems to identify optimal conditions for functional expression.

  • Protein Yield Limitations:

    • Challenge: GPCRs often express at lower levels than soluble proteins.

    • Solution: Screen multiple expression constructs with different fusion partners, promoters, and host strains. Consider specialized expression systems designed for membrane proteins.

  • Tag Interference with Function:

    • Challenge: Tags like the N-terminal 10xHis-tag may interfere with ligand binding or signaling.

    • Solution: Compare tagged versus untagged versions of the protein or use cleavable tags. Place tags at positions less likely to interfere with function based on structural knowledge.

  • Species-Specific Signaling Differences:

    • Challenge: Recombinant Ateles paniscus MC1R may exhibit different signaling properties compared to human MC1R.

    • Solution: Include appropriate species-matched controls in functional studies. Consider the cellular context when interpreting results from heterologous expression systems.

  • Complex Formation with Accessory Proteins:

    • Challenge: MC1R function may depend on interactions with melanocortin receptor accessory proteins not present in heterologous systems.

    • Solution: Co-express relevant accessory proteins when studying receptor function. Consider native cell backgrounds that express appropriate cofactors.

  • Non-Specific Antibody Binding:

    • Challenge: Antibody detection of MC1R can show non-specific labeling .

    • Solution: Use monoclonal antibodies with validated specificity. Include appropriate negative controls and blocking conditions to minimize background.

By anticipating these challenges and implementing appropriate solutions, researchers can significantly improve the reliability and reproducibility of experiments involving recombinant MC1R proteins.

How does the cAMP-microphthalmia signaling axis regulate melanocyte differentiation and melanogenesis?

The cAMP-microphthalmia signaling axis represents a central regulatory pathway in melanocyte differentiation and melanogenesis:

  • Pathway Initiation:
    The signaling cascade begins when MC1R is activated by ligands such as α-MSH, leading to increased cAMP production through G-protein mediated activation of adenylate cyclase . This elevated cAMP serves as the initial second messenger in the signaling cascade.

  • Transcriptional Regulation of Microphthalmia:

    • cAMP elevation leads to a rapid and robust increase in microphthalmia protein levels, with maximum effect observed between 3-5 hours after stimulation

    • The increase occurs through a transcriptional mechanism, as evidenced by Northern blot experiments showing 8-9 fold increases in microphthalmia mRNA levels following forskolin treatment

    • The microphthalmia promoter contains a classical cAMP response element (CRE) that binds transcription factors of the CREB family

    • Mutation of this CRE motif markedly reduces the response to cAMP-elevating agents, demonstrating its critical role in cAMP-induced microphthalmia expression

  • Molecular Mechanisms:

    • CREB phosphorylation allows interaction with the transcriptional coactivator CBP

    • This interaction is essential for CRE-mediated transcriptional activation

    • The microphthalmia protein itself has been reported to interact with CBP, suggesting a potential feedback mechanism

  • Temporal Dynamics:

    • The effect of cAMP on microphthalmia expression is transient, with levels decreasing after 24 hours

    • This temporal pattern suggests tight regulation of the pathway with potential feedback mechanisms

  • Functional Outcomes:

    • Activated microphthalmia functions as a transcription factor that regulates multiple genes involved in melanocyte differentiation and melanogenesis

    • This includes the regulation of tyrosinase and other melanogenic enzymes essential for melanin production

Understanding this signaling axis provides important insights into the molecular control of pigmentation and offers potential targets for therapeutic intervention in pigmentation disorders.

What evolutionary insights can be gained from comparative studies of MC1R across primate species?

Comparative studies of MC1R across primate species offer valuable evolutionary insights into pigmentation adaptation:

  • Sequence Evolution and Selection Pressure:
    Comparison of MC1R sequences between Ateles paniscus (Black spider monkey) and humans reveals both conserved domains and variable regions . These patterns of conservation and divergence provide evidence of:

    • Functional constraints maintaining core signaling mechanisms

    • Selective pressures potentially related to habitat, UV exposure, and social signaling

    • Balancing selection in regions associated with pigmentation diversity

  • Correlation with Phenotypic Variation:

    • The Black spider monkey (Ateles paniscus) exhibits distinctive dark coloration, potentially associated with specific MC1R variants

    • Comparing MC1R sequence and function with phenotypic characteristics across primates can reveal structure-function relationships

    • These comparisons help identify which amino acid substitutions have functional consequences for pigmentation

  • Adaptation to Environmental Pressures:

    • Primate species inhabiting different ecological niches show MC1R adaptations that may correlate with:

      • UV radiation exposure levels in different habitats

      • Thermoregulation requirements

      • Camouflage needs for predator avoidance

    • These adaptations represent evolutionary solutions to environmental challenges

  • Molecular Mechanism Conservation:
    The cAMP signaling pathway activated by MC1R appears broadly conserved across primates, as evidenced by:

    • Similar downstream activation of microphthalmia transcription factor

    • Conservation of CRE elements in target gene promoters

    • This conservation suggests fundamental importance of these pathways in melanocyte function

  • Implications for Human Evolution:

    • Understanding MC1R variation across primates provides context for human MC1R polymorphisms

    • This comparative approach can help identify when specific MC1R variants emerged in human evolutionary history

    • Such insights contribute to our understanding of human adaptation to different geographic regions and UV environments

Comparative studies of primate MC1R thus serve as a window into the evolutionary forces shaping pigmentation diversity and provide a broader context for understanding human pigmentation genetics.

What potential applications exist for MC1R in understanding and treating pigmentation disorders?

MC1R research offers significant potential for understanding and developing treatments for pigmentation disorders:

  • Diagnostic Applications:

    • Recombinant MC1R proteins can be used to develop antibodies and diagnostic tools for assessing receptor expression levels in tissue samples

    • Studying MC1R genetic variants and their functional consequences helps identify risk factors for conditions like melanoma

    • Functional assays using recombinant MC1R enable classification of receptor variants based on signaling capacity

  • Therapeutic Target Development:

    • Understanding the cAMP-microphthalmia signaling axis controlled by MC1R provides multiple intervention points

    • Several therapeutic approaches can be envisioned:

      • MC1R agonists for treating hypopigmentation disorders

      • Pathway modulators targeting downstream components for conditions involving dysfunctional MC1R

      • Gene therapy approaches to restore normal MC1R function

  • Precision Medicine Approaches:

    • MC1R genotyping could inform personalized treatment strategies for pigmentation disorders

    • Recombinant variants mimicking patient mutations allow functional testing to predict treatment response

    • Cell-based assays using patient-derived cells and recombinant MC1R can guide therapy selection

  • Broader Applications in Melanocyte Biology:

    • Research on MC1R signaling contributes to understanding melanocyte development, migration, and survival

    • These insights extend to melanocyte-derived tumors such as melanoma

    • The cAMP pathways regulated by MC1R intersect with other signaling networks relevant to melanocyte pathology

  • Pharmaceutical Development:

    • Recombinant MC1R proteins serve as tools for screening potential therapeutic compounds

    • Structure-based drug design targeting MC1R or downstream components

    • Development of peptide analogs of MSH with enhanced specificity and pharmacokinetic properties

The continued investigation of MC1R structure, function, and signaling pathways thus holds promise for both understanding the molecular basis of pigmentation disorders and developing targeted therapeutic strategies.

What controls and validation steps are essential when working with recombinant MC1R in signaling studies?

When designing experiments with recombinant MC1R for signaling studies, implementing proper controls and validation steps is crucial for generating reliable and interpretable results:

  • Expression Validation:

    • Western Blot Analysis: Confirm expression of recombinant MC1R at the expected molecular weight (approximately 55-60 kD)

    • Subcellular Localization: Verify proper membrane localization using immunofluorescence or membrane fractionation

    • Quantification: Determine expression levels to ensure consistency across experiments and appropriate comparison with endogenous receptor levels

  • Functional Validation:

    • Ligand Binding Assays: Confirm ability to bind natural ligands (MSH, ACTH) with appropriate affinity

    • cAMP Accumulation: Verify that receptor activation leads to increased cAMP production

    • Dose-Response Relationships: Establish concentration-dependent effects of agonists to confirm receptor functionality

  • Signaling Pathway Controls:

    • Positive Controls: Include direct adenylate cyclase activators like forskolin to bypass receptor activation

    • Pathway Inhibitors: Use specific inhibitors (e.g., PKA inhibitors) to confirm pathway specificity

    • Receptor Antagonists: Include selective MC1R antagonists to confirm receptor-mediated effects

  • Experimental System Controls:

    • Untransfected Cells: Include cells without MC1R expression as negative controls

    • Mock Transfections: Control for non-specific effects of transfection procedures

    • Species-Matched Controls: When studying Ateles paniscus MC1R, include appropriate comparisons with other primate MC1Rs

  • Temporal Considerations:

    • Time-Course Analysis: Include multiple timepoints to capture transient responses (e.g., peak microphthalmia expression at 3-5 hours)

    • Time-Matched Controls: Ensure control samples are processed at identical timepoints

  • Downstream Readout Validation:

    • Multiple Detection Methods: Validate key findings using complementary techniques (e.g., both Western blot and immunofluorescence for microphthalmia)

    • Specificity Controls: Confirm antibody specificity, particularly for microphthalmia detection which has shown non-specific labeling with polyclonal antibodies

    • Reporter Assay Controls: Include promoter constructs with mutated response elements (e.g., CRE mutations) to confirm specificity

Implementation of these validation steps and controls ensures experimental rigor and facilitates proper interpretation of results when studying MC1R signaling pathways.

How can researchers effectively compare MC1R signaling across different cell types and experimental systems?

  • Standardization of Receptor Expression:

    • Quantitative Assessment: Use techniques such as flow cytometry or quantitative Western blotting to standardize receptor expression levels

    • Inducible Expression Systems: Consider using tetracycline-inducible or similar systems to achieve comparable expression levels

    • Single-Cell Analysis: When possible, correlate signaling responses with receptor expression at the single-cell level

  • Baseline Characterization:

    • Endogenous Signaling Components: Profile each cell type for expression of relevant G-proteins, adenylate cyclase isoforms, and phosphodiesterases

    • Basal cAMP Levels: Determine baseline cAMP concentrations in each cell type

    • Expression of Downstream Effectors: Quantify levels of CREB, microphthalmia, and other relevant transcription factors

  • Normalization Strategies:

    • Internal Controls: Include stimulation with forskolin to directly activate adenylate cyclase as a system-independent reference

    • Relative Response Calculations: Express data as fold-change over baseline rather than absolute values

    • Pathway Saturation Controls: Determine maximum pathway activation capacity in each system

  • Melanocyte-Specific Considerations:

    • Pigmentation Status: Account for differences between melanotic and amelanotic cell lines

    • Developmental Origin: Consider differences between neural crest-derived melanocytes and other cell types

    • Species Differences: When comparing across species, account for evolutionary differences in signaling networks

  • Methodological Consistency:

    • Standardized Protocols: Use identical stimulation protocols, reagent concentrations, and incubation times

    • Parallel Processing: Process samples from different cell types simultaneously when possible

    • Assay Validation: Confirm that detection methods have similar dynamic ranges across cell types

  • Data Analysis Approaches:

    • Multiparametric Analysis: Measure multiple signaling nodes simultaneously when possible

    • Kinetic Modeling: Consider analyzing rate constants rather than endpoint measurements

    • Statistical Framework: Use appropriate statistical methods for comparing response magnitudes and kinetics

  • Contextual Interpretation:

    • Cell Type-Specific Functions: Interpret findings in the context of the physiological role of each cell type

    • Pathway Cross-talk: Consider differences in interactions with other signaling pathways

    • Compensation Mechanisms: Account for potential feedback mechanisms that may differ between systems

What are the key considerations for designing experiments to study the role of MC1R in melanogenesis and pigmentation?

Designing experiments to investigate MC1R's role in melanogenesis requires careful consideration of multiple factors to ensure physiological relevance and interpretable results:

  • Model System Selection:

    • Cell Lines: Choose between established melanoma cell lines (e.g., B16) and primary melanocytes

    • 3D Culture Systems: Consider organotypic models that better recapitulate tissue architecture

    • In Vivo Models: Select appropriate animal models reflecting the research question

    • Comparative Approach: Include multiple species when studying evolutionary aspects of MC1R function

  • Receptor Manipulation Strategies:

    • Overexpression: Use recombinant MC1R to study gain-of-function effects

    • Knockdown/Knockout: Employ siRNA or CRISPR approaches to reduce or eliminate MC1R expression

    • Variant Expression: Introduce specific MC1R variants to study their functional consequences

    • Pharmacological Modulation: Use selective agonists (α-MSH) or antagonists to manipulate receptor activity

  • Signaling Pathway Analysis:

    • Proximal Readouts: Measure immediate consequences of receptor activation (cAMP production)

    • Transcriptional Regulation: Assess effects on key transcription factors like microphthalmia

    • Enzyme Induction: Monitor changes in melanogenic enzymes (tyrosinase, TRP1, TRP2)

    • Pathway Dissection: Use specific inhibitors to delineate contributions of different signaling branches

  • Temporal Considerations:

    • Acute vs. Chronic Effects: Distinguish between immediate signaling events and long-term adaptive responses

    • Critical Time Windows: Include early timepoints (3-5 hours) when studying microphthalmia induction

    • Developmental Context: Consider melanocyte developmental stage when studying differentiation effects

  • Melanin Production Assessment:

    • Quantitative Measurement: Use spectrophotometric or HPLC-based methods to quantify melanin

    • Qualitative Analysis: Differentiate between eumelanin and pheomelanin production

    • Microscopic Evaluation: Assess changes in melanosome formation and distribution

    • Direct Correlation: Link receptor activation to changes in melanin content

  • Environmental Factors:

    • UV Exposure: Include UV radiation as a physiological stimulus for melanogenesis

    • Extracellular pH: Control and monitor pH as it can affect receptor function

    • Paracrine Factors: Consider keratinocyte-derived factors that modulate melanocyte function in vivo

  • Validation in Human Tissues:

    • Skin Sample Analysis: Correlate findings with observations in human skin samples

    • Genetic Association: Connect experimental results with known MC1R polymorphisms in human populations

    • Pigmentation Disorders: Consider implications for conditions like albinism or hyperpigmentation

By addressing these considerations in experimental design, researchers can develop more comprehensive and physiologically relevant models of MC1R function in melanogenesis and pigmentation biology.

What are the major unresolved questions in MC1R biology that could be addressed using recombinant proteins?

Despite significant advances in understanding MC1R function, several important questions remain unresolved that could be specifically addressed using recombinant protein approaches:

  • Structural Dynamics of Receptor Activation:

    • How do conformational changes propagate through MC1R upon ligand binding?

    • What structural features determine G-protein coupling specificity?

    • How do MC1R variants alter receptor structure and function at the molecular level?

  • Signaling Bias and Complexity:

    • Does MC1R exhibit biased signaling with different ligands (α-MSH vs β-MSH vs ACTH)?

    • Are there G-protein independent signaling pathways activated by MC1R?

    • How does MC1R signaling integrate with other pathways regulating melanogenesis?

  • Receptor Regulation Mechanisms:

    • What molecular mechanisms control MC1R desensitization and internalization?

    • How is MC1R expression regulated at transcriptional and post-translational levels?

    • What factors determine cell surface receptor density and turnover?

  • Species-Specific Functional Differences:

    • How do functional properties of Ateles paniscus MC1R differ from human MC1R?

    • What evolutionary adaptations in MC1R structure contribute to species-specific pigmentation patterns?

    • Are there differences in signaling pathway coupling efficiency across primate species?

  • Protein-Protein Interactions:

    • What is the complete interactome of MC1R beyond G-proteins?

    • How do melanocortin receptor accessory proteins modulate MC1R function?

    • Are there unidentified scaffolding proteins that organize MC1R signaling complexes?

  • Pharmacological Targeting Opportunities:

    • Can species-specific differences in MC1R be exploited to develop selective ligands?

    • What binding site features could be targeted for therapeutic development?

    • How might allosteric modulators affect MC1R function?

  • Feedback Regulation of the cAMP-Microphthalmia Axis:

    • What mechanisms explain the transient nature of microphthalmia induction?

    • Are there direct feedback loops between microphthalmia and MC1R expression?

    • How is pathway sensitivity regulated during prolonged stimulation?

Recombinant MC1R proteins provide versatile tools to address these questions through approaches including structural studies, reconstitution in artificial membrane systems, protein-protein interaction screens, and comparative functional analyses across species.

How might advances in structural biology and protein engineering impact future MC1R research?

Emerging technologies in structural biology and protein engineering promise to revolutionize MC1R research and open new avenues for investigation:

  • High-Resolution Structural Determination:

    • Cryo-EM Advances: Recent breakthroughs in single-particle cryo-electron microscopy may enable visualization of MC1R in different conformational states

    • X-ray Crystallography: Novel crystallization approaches for GPCRs could reveal atomic-level details of MC1R structure

    • Integrative Structural Biology: Combining multiple techniques (NMR, HDX-MS, cross-linking) may provide comprehensive structural models

  • Dynamic Structural Analyses:

    • Single-Molecule FRET: Monitoring conformational changes in real-time during receptor activation

    • Hydrogen-Deuterium Exchange: Mapping conformational dynamics and ligand-induced changes

    • Molecular Dynamics Simulations: Computational approaches to study receptor dynamics in membrane environments

  • Engineered MC1R Variants:

    • Stabilized Receptors: Introduction of thermostabilizing mutations to facilitate structural studies

    • Biosensor Development: Creation of MC1R-based sensors for real-time monitoring of ligand binding or conformational changes

    • Photo-activatable Receptors: Development of optogenetic tools based on MC1R for precise temporal control of signaling

  • Artificial Intelligence Applications:

    • Structure Prediction: AlphaFold and similar AI approaches to predict MC1R structures across species

    • Ligand Discovery: AI-driven virtual screening to identify novel MC1R modulators

    • Sequence-Function Relationships: Machine learning to predict functional consequences of MC1R variants

  • Nanobody and Aptamer Development:

    • Creation of conformational state-specific binders for MC1R

    • Development of tools to selectively modulate specific signaling pathways

    • Engineered probes for studying MC1R in native tissues

  • Advanced Expression Systems:

    • Cell-Free Systems: Development of optimized cell-free expression platforms for GPCRs

    • Synthetic Cell Membranes: Reconstitution in defined lipid environments to study membrane effects

    • Directed Evolution: Selection strategies to generate MC1R variants with enhanced stability or specific functions

  • Impact on Therapeutic Development:

    • Structure-based drug design targeting specific MC1R conformations

    • Development of biased ligands that selectively activate beneficial pathways

    • Personalized medicine approaches based on structural understanding of MC1R variants

These technological advances will likely transform our understanding of MC1R structure-function relationships and enable more precise manipulation of MC1R signaling for both research and therapeutic purposes.

What is the potential for cross-disciplinary applications of MC1R research beyond pigmentation biology?

MC1R research extends beyond pigmentation biology, offering insights and applications across multiple scientific disciplines:

  • Immune System Regulation:

    • MC1R expression has been detected in immune cells, suggesting roles beyond melanocytes

    • The anti-inflammatory effects of α-MSH may be partly mediated through MC1R on immune cells

    • Understanding these mechanisms could inform new approaches to inflammatory diseases

  • Pain Perception and Analgesia:

    • Emerging evidence suggests MC1R variants influence pain sensitivity and analgesic responses

    • MC1R signaling may modulate nociceptive pathways through cAMP-dependent mechanisms similar to those characterized in melanocytes

    • This connection creates opportunities for novel pain management approaches

  • Neuroscience Applications:

    • The cAMP-CREB signaling axis regulated by MC1R has parallels in neuronal function

    • Insights into transcriptional regulation mechanisms may apply to neuronal plasticity

    • Understanding G-protein coupled receptor dynamics in MC1R provides broader principles applicable to neuronal receptors

  • Cancer Biology Beyond Melanoma:

    • The role of cAMP signaling in cell proliferation and differentiation extends to multiple cancer types

    • Mechanisms of transcriptional regulation identified in MC1R research may apply to other cancer contexts

    • Pharmacological approaches developed for MC1R may have applications in other GPCR-driven cancers

  • Evolutionary Biology and Adaptation:

    • MC1R variation across species provides a model for studying molecular evolution and adaptation

    • Comparing Ateles paniscus MC1R with other primate variants offers insights into selective pressures

    • This comparative approach informs broader understanding of genetic adaptation to environmental conditions

  • Drug Delivery and Targeting:

    • Melanocyte-specific expression of MC1R provides opportunities for targeted delivery to melanocytes

    • Engineered MSH analogs could serve as vehicles for delivering therapeutic cargo specifically to MC1R-expressing cells

    • This approach could reduce off-target effects in treatments for pigmentation disorders or melanoma

  • Biomarker Development:

    • MC1R variants and expression patterns may serve as biomarkers for various conditions

    • Analysis of MC1R signaling pathway components could provide diagnostic or prognostic information

    • These biomarkers might extend beyond pigmentation to inflammatory or neurological conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.