Recombinant Atelocynus microtis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize development to meet your specifications.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Atelocynus microtis (Short-eared dog) (Dusicyon microtis)
Target Names
Target Protein Sequence
MAYPFQLGLQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETVWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTQELKPGELRLLEVDNRVVLPMEMTVRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMAMRPGLYYGQCSEICGSNHSFMPIVLEMVPLSYFETWSALMV
Uniprot No.

Target Background

Function
Recombinant Atelocynus microtis Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the Cu(A) center of subunit 2 and heme A of subunit 1 to the binuclear center (BNC) in subunit 1, composed of heme A3 and Cu(B). The BNC then reduces molecular oxygen to two water molecules using four electrons from cytochrome c and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-CO2 and what is its biological significance?

Cytochrome c oxidase subunit 2 (MT-CO2) is a highly conserved protein encoded by the mitochondrial genome that plays a crucial role in cellular respiration. It is directly responsible for the initial transfer of electrons from cytochrome c to cytochrome c oxidase (COX), which is essential for ATP production during oxidative phosphorylation . In Atelocynus microtis (Small-eared dog), as in other mammals, this protein functions as part of Complex IV of the electron transport chain. The biological significance of MT-CO2 extends beyond basic energy metabolism, as variations in its structure can influence metabolic efficiency, adaptability to environmental conditions, and potentially play a role in the species' response to climate-induced habitat changes . The protein's conservation across species, coupled with specific variations, makes it valuable for both evolutionary studies and ecological assessments.

What expression systems are recommended for producing recombinant Atelocynus microtis MT-CO2?

For recombinant production of Atelocynus microtis MT-CO2, E. coli expression systems have demonstrated reliable results, as documented in current research preparations . When using E. coli for expression, the following methodological considerations are critical:

  • Vector selection: Systems incorporating N-terminal tags (particularly 10xHis tags) have proven effective for subsequent purification steps .

  • Codon optimization: Despite being a mammalian protein expressed in a bacterial system, proper codon optimization can significantly improve yield without altering the final protein structure.

  • Growth conditions: Induction parameters (temperature, IPTG concentration, duration) should be optimized to balance between expression level and formation of inclusion bodies.

  • Purification strategy: Immobilized metal affinity chromatography (IMAC) utilizing the His-tag is the primary purification approach, followed by additional chromatography steps as needed for experimental requirements.

The recombinant protein is typically provided either in liquid form or as a lyophilized powder, with the latter offering extended shelf life (approximately 12 months at -20°C/-80°C compared to 6 months for liquid preparations) .

How does the structure and function of Atelocynus microtis MT-CO2 compare with MT-CO2 from other canids and mammals?

Comparative analysis of MT-CO2 sequences across canid species reveals important structural and functional insights with significant research implications. When comparing Atelocynus microtis MT-CO2 with that of other mammals, several key observations emerge:

  • Conservation patterns: Certain domains show high conservation across all mammals, particularly those directly involved in electron transfer functionality. For example, the regions containing metal-binding sites for copper atoms are nearly identical across species, reflecting their essential role in enzyme function.

  • Species-specific variations: The sequence of A. microtis MT-CO2 exhibits specific amino acid substitutions that may reflect adaptations to the species' ecological niche in the Amazon rainforest. These variations often occur in transmembrane regions that might influence protein stability in different cellular environments.

  • Phylogenetic significance: As evidenced in the genomic data from resources like 10kTrees, COX2 sequences are available for 157 species and have proven valuable for constructing phylogenetic relationships . In the context of canids, these sequences help establish evolutionary relationships that align with ecological and morphological data.

Researchers conducting comparative studies should consider employing multiple sequence alignment tools followed by three-dimensional modeling to identify structurally significant differences that might influence protein-protein interactions with both mitochondrial and nuclear-encoded components of the respiratory complex.

What methodological approaches should be used when studying the functional characteristics of recombinant MT-CO2?

When investigating the functional properties of recombinant Atelocynus microtis MT-CO2, researchers should employ a multi-faceted experimental approach:

  • Enzymatic activity assays: Cytochrome c oxidase activity can be measured spectrophotometrically by monitoring the oxidation of reduced cytochrome c at 550 nm. For recombinant MT-CO2, this requires reconstitution with other subunits of the complex, which presents methodological challenges but provides direct functional data.

  • Protein-protein interaction studies:

    • Pull-down assays utilizing the His-tag to identify binding partners

    • Surface plasmon resonance (SPR) to quantify binding kinetics with cytochrome c

    • Cross-linking experiments followed by mass spectrometry to map interaction interfaces

  • Structural analysis protocols:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Limited proteolysis to identify stable domains

    • Where feasible, X-ray crystallography or cryo-EM for high-resolution structural determination

  • Reconstitution experiments: Incorporation of the recombinant protein into liposomes or nanodiscs can provide a membrane environment that better mimics physiological conditions for functional studies.

Researchers should note that the recombinant protein's storage and handling significantly impact functional assays. The recommended protocol involves reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with the addition of 5-50% glycerol for long-term storage, minimizing freeze-thaw cycles that can compromise functional integrity .

How might climate change impact MT-CO2 function in Atelocynus microtis populations?

Research on the ecological vulnerability of Atelocynus microtis indicates that this species is highly forest-dependent and faces potential habitat losses of up to 91% in the Brazilian Amazon due to climate change . This severe habitat restriction raises important questions about the adaptive pressure on mitochondrial genes like MT-CO2:

  • Metabolic adaptation requirements: As A. microtis populations become restricted to smaller habitat fragments with potentially different resource availability, selective pressure on metabolic efficiency may increase. MT-CO2, as a critical component of energy production, could experience selection for variants that optimize energy production under new environmental constraints.

  • Temperature effects on protein function: Climate change will likely alter the temperature regimes within the species' range. Research on other mammals has shown that mitochondrial enzyme kinetics, including those of cytochrome c oxidase, can be temperature-dependent. Therefore, studying the thermal stability and activity profiles of A. microtis MT-CO2 across a range of temperatures could provide insights into potential adaptive limitations.

  • Genetic bottleneck considerations: Reduced population sizes resulting from habitat loss may lead to genetic bottlenecks, potentially affecting MT-CO2 genetic diversity. Comparing the genetic diversity of MT-CO2 sequences from populations across different habitat fragments could provide early indicators of this effect.

  • Interspecies competition factors: As ecological traps reshape species distributions, A. microtis may face new competitive pressures from other canids like Cerdocyon thous that show greater ecological plasticity . These competitive interactions could indirectly influence selection on metabolic efficiency genes including MT-CO2.

Researchers investigating these climate-related impacts should consider designing experiments that measure MT-CO2 function under conditions simulating projected climatic changes, potentially including thermal stress tests and comparative analyses of samples from populations in differently impacted habitat regions.

What approaches are recommended for studying MT-CO2 evolution in the context of canid adaptation to ecological niches?

The study of MT-CO2 evolution in canids requires integration of molecular, ecological, and demographic approaches:

  • Sequence-based selection analysis: The ratio of nonsynonymous to synonymous substitutions (ω) can identify selective pressures on MT-CO2. As observed in other species, most codons in MT-CO2 are likely under strong purifying selection (ω << 1), while approximately 4% of sites may evolve under relaxed selective constraint (ω = 1) . Site-specific and branch-site maximum likelihood models can detect signatures of positive selection that might correlate with ecological specialization.

  • Structural mapping of variable sites: Amino acid substitutions identified between canid species should be mapped onto protein structure models to determine if they cluster in functionally significant regions. This approach can reveal whether variations occur at protein-protein interaction interfaces that might influence respiratory complex assembly or function.

  • Comparative physiological studies: When possible, researchers should correlate MT-CO2 sequence variations with measurable physiological parameters such as:

    • Basal metabolic rate differences between canid species

    • Thermal tolerance ranges

    • Exercise capacity and recovery rates

  • Integration with ecological data: MT-CO2 variations should be interpreted in the context of species-specific ecological parameters:

    • Habitat type and climate variables

    • Activity patterns (diurnal/nocturnal)

    • Hunting strategies and prey types

    • Range size and population density

This integrated approach allows researchers to test hypotheses about whether observed MT-CO2 variations represent adaptive responses to ecological pressures or are primarily the result of neutral evolutionary processes. The relatively forest-dependent nature of Atelocynus microtis compared to more adaptable canids like Cerdocyon thous provides a valuable comparative framework for such studies .

What are the recommended storage and handling protocols to ensure optimal activity of recombinant MT-CO2 in experimental settings?

Maintaining the structural and functional integrity of recombinant Atelocynus microtis MT-CO2 requires careful attention to storage and handling protocols:

  • Initial processing:

    • Centrifuge vials briefly before opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended for maximum stability)

  • Storage recommendations:

    • Store at -20°C/-80°C in small working aliquots to minimize freeze-thaw cycles

    • For short-term use (up to one week), working aliquots can be stored at 4°C

    • Shelf life is approximately 12 months for lyophilized preparations and 6 months for liquid formulations when stored at -20°C/-80°C

  • Handling considerations:

    • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity

    • Maintain pH stability by using Tris/PBS-based buffers at pH 8.0

    • Include 6% trehalose in storage buffers to enhance protein stability

  • Quality control metrics:

    • Confirm protein purity via SDS-PAGE (should exceed 90%)

    • Verify protein identity through Western blotting using anti-His antibodies or MT-CO2-specific antibodies

    • Assess functional activity periodically if the protein will be used for enzymatic studies

Researchers should document any deviations from these protocols in their experimental methods, as storage conditions can significantly impact experimental outcomes, particularly in functional studies or structural analyses.

How can recombinant MT-CO2 be used in conservation biology research for endangered canids?

Recombinant MT-CO2 provides valuable research tools for conservation biology applications focusing on endangered canids like Atelocynus microtis:

  • Development of species-specific antibodies: Using recombinant A. microtis MT-CO2, researchers can develop highly specific antibodies for:

    • Non-invasive sample identification from environmental DNA

    • Population monitoring through fecal or hair sample analysis

    • Tissue sample verification in forensic applications related to wildlife trafficking

  • Mitochondrial health assessment: As a key component of the respiratory chain, MT-CO2 can serve as a biomarker for mitochondrial health in wild populations:

    • Samples collected from different populations can be analyzed for MT-CO2 expression levels

    • Functional variations can be assessed through activity assays

    • Results can be correlated with habitat quality, providing physiological evidence of environmental stress

  • Genetic diversity monitoring: Sequencing of the MT-CO2 gene across populations can:

    • Track genetic diversity changes over time

    • Identify population fragmentation effects

    • Serve as one component of genetic management plans for captive breeding programs

  • Climate adaptation research: Given that A. microtis faces significant habitat loss due to climate change , studying MT-CO2 variants across populations experiencing different climate pressures may provide insights into adaptation potential and guide conservation prioritization.

These applications demonstrate how molecular tools based on recombinant proteins can directly contribute to conservation efforts beyond traditional population genetics approaches.

What are the technical challenges in expressing and purifying fully functional MT-CO2 for structural studies?

Researchers pursuing structural studies of Atelocynus microtis MT-CO2 face several technical challenges:

To address these challenges, researchers often employ a multi-faceted approach combining detergent screening, various expression systems, and complementary structural analysis techniques including cryo-EM, which has become increasingly valuable for membrane protein structural determination.

How do amino acid variations in MT-CO2 across canid species correlate with metabolic adaptations?

Comparative analysis of MT-CO2 sequences across canid species reveals patterns that may reflect metabolic adaptations to diverse ecological niches:

  • Activity pattern correlations:

    • Variations in specific amino acid residues may correlate with species' activity patterns (nocturnal vs. diurnal)

    • These variations could affect electron transfer efficiency under different temperature regimes

  • Habitat-specific adaptations:

    • Forest-dependent species like Atelocynus microtis show sequence patterns distinct from canids in more open habitats

    • These differences may reflect adaptations to varying oxygen availability, temperature fluctuations, or prey types

  • Metabolic rate considerations:

    • Amino acid substitutions in substrate-binding regions may influence the efficiency of electron transfer

    • These variations could potentially correlate with differences in basal metabolic rates across canid species

  • Thermal adaptation signatures:

    • As observed in other species, MT-CO2 variations may contribute to adaptations to different thermal environments

    • Sites under positive selection, identified through likelihood models, often correlate with thermal adaptation

A methodological approach to studying these correlations would include:

  • Phylogenetically controlled comparative analyses

  • Integration of physiological measurements with sequence data

  • Experimental validation using recombinant proteins with site-directed mutations

  • Ecological and behavioral data to provide context for molecular findings

This integrative approach can provide insights into how mitochondrial adaptations contribute to the remarkable ecological diversity seen in canids, from the rainforest-dwelling Atelocynus microtis to more widespread and adaptable species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.