Recombinant Atherina boyeri Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Sequence Features

The recombinant protein retains the native structure of wild-type rhodopsin, featuring:

PropertyDetails
Amino Acid Sequence354 residues (Full-length protein)
Transmembrane Domains7 α-helical regions characteristic of GPCRs
Chromophore Binding SiteLys296 residue forming Schiff-base linkage with 11-cis-retinal
Post-Translational ModificationsCovalently bound retinal chromophore (absent in recombinant apo-opsin)

Key structural motifs include conserved residues critical for retinal binding and G-protein activation . The sequence begins with MNGTEGPYFYIPMLNTTGVVR... and terminates with ...VSPA .

Production and Biochemical Properties

Recombinant Atherina boyeri rhodopsin is expressed in heterologous systems and purified for research use:

ParameterSpecification
Expression SystemNot explicitly stated, but likely mammalian or insect cells
Storage ConditionsTris-based buffer with 50% glycerol; store at -20°C or -80°C
PurityOptimized for ELISA and structural studies
StabilitySensitive to repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week

The protein is tagged during production for affinity purification, though the exact tag (e.g., His-tag, FLAG) depends on batch-specific protocols .

Functional Assays

  • Signal Transduction: Measures G-protein (transducin) activation kinetics in response to light .

  • Drug Screening: Platform for testing small molecules targeting retinal-binding pockets or stabilizing misfolded mutants .

Disease Relevance

Mutations in rhodopsin are linked to retinal degenerations such as retinitis pigmentosa (RP). While most studies focus on human rhodopsin, Atherina boyeri rhodopsin provides a model for:

  • Class B1 Mutations: Analogous to human P23H variants causing ER stress and UPR activation .

  • Energy Metabolism Defects: Overexpression in photoreceptor cells disrupts oxidative phosphorylation, mimicking RP-associated metabolic failure .

Future Directions

  • Gene Therapy Development: Insights from Atherina boyeri rhodopsin folding studies could inform CRISPR-based correction strategies for human RHO mutations .

  • Cryo-EM Studies: High-resolution structural analysis to compare activation mechanisms across species .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-354
Protein Length
full length protein
Species
Atherina boyeri (Big-scale sand smelt)
Target Names
rho
Target Protein Sequence
MNGTEGPYFYIPMLNTTGVVRSPYEYPQYYLVNPAAYAVLGAYMFFLILVGFPINFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTIYTSMHGYFVLGRLGCNVEGFSATLG GEIALWSLVVLAIERWVVVCKPISNFRFGENHAIMGVAFTWFMAAACAVPPLFGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFTCHFCIPLMVVFFCYGRLVCAVKEAAAAQQES ETTQRAEREVTRMVIIMVVSFLVSWVPYASVAWYIFTHQGSEFGPLFMTIPAFFAKSSSI YNPMIYICMNKQFRHCMITTLCCGKNPFEEEEGASSTASKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Photoreceptor essential for image-forming vision in low light conditions. While most saltwater fish species utilize retinal as a chromophore, most freshwater fish utilize 3-dehydroretinal or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is the rhodopsin gene in Atherina boyeri and how does it compare to other species?

The rhodopsin gene (rho) in Atherina boyeri is a nuclear protein-coding gene used in phylogenetic analysis. In studies examining genetic differentiation and phylogenetic relationships of big-scale sand smelt (Atherina boyeri), the rhodopsin gene has been sequenced alongside mitochondrial genes like cytochrome oxidase I (coI), cytochrome b (cytb), and the control region. The analysis involved a total of 2180 base pairs across all these genes for 143 specimens .

Comparative studies have shown that rhodopsin sequences can help distinguish between different populations and lineages of Atherina boyeri. Research has revealed three different and well-divergent lineages in Greece alone: a lagoon form (with clear distinction between Aegean and Ionian Sea populations) and two marine forms .

What are the structural characteristics of Atherina boyeri rhodopsin?

While the search results don't provide specific structural details of Atherina boyeri rhodopsin, general rhodopsin structure includes seven transmembrane domains (TM I-VII). In rhodopsins, 11-cis-retinal covalently binds to opsin at the epsilon amino group of Lys296 within TM VII . Critical interhelical interactions, such as those between TM III and TM V (specifically the Glu122, His211 salt bridge), are essential for proper function .

The retinal binding pocket and the interactions between the protonated retinal Schiff base and counterion(s) play crucial roles in determining the rhodopsin's absorption wavelength (λmax). The distortion of the retinal polyene chain induced by steric interactions with surrounding residues also affects spectral tuning .

How is the absorption wavelength (λmax) of rhodopsins determined experimentally?

The experimental determination of rhodopsin absorption wavelengths typically involves:

  • Gene synthesis and protein expression in a suitable system (such as Escherichia coli)

  • Protein expression in the presence of all-trans retinal (typically 10 μM)

  • Measurement using UV-visible spectroscopy

  • Observation of absorption changes upon bleaching of the expressed rhodopsins through a hydrolysis reaction with hydroxylamine

This methodology has been successfully applied to measure λmax in numerous rhodopsin variants. In one study, researchers expressed selected rhodopsin genes in E. coli cells, and the proteins that showed substantial coloring (indicating high expression of folded protein) had their λmax determined by observing ultraviolet-visible absorption changes .

What expression systems are most effective for recombinant Atherina boyeri rhodopsin production?

Based on the research data available, E. coli expression systems are commonly used for rhodopsin expression. When working with putative ion-pumping rhodopsins derived from archaeal and bacterial origins, E. coli has proven to be an effective expression system .

For recombinant Atherina boyeri rhodopsin specifically, an E. coli system would likely be appropriate given its proven success with other rhodopsins. In one study examining rhodopsins, researchers synthesized selected genes, introduced them into E. coli cells, and expressed the proteins in the presence of 10 μM all-trans retinal .

The key factors for successful expression include:

  • Optimization of codon usage for E. coli

  • Proper incorporation of the all-trans retinal chromophore

  • Monitoring protein folding and membrane insertion

  • Temperature and induction condition optimization

How can I design experiments to identify spectral-tuning residues in Atherina boyeri rhodopsin?

Experimental design for identifying spectral-tuning residues in Atherina boyeri rhodopsin can benefit from both traditional approaches and newer machine learning (ML) methods:

Traditional Mutagenesis Approach:

  • Identify key residues around the retinal chromophore (approximately 24 positions have been shown to play significant roles in predicting absorption wavelengths)

  • Design site-directed mutagenesis experiments targeting these positions

  • Express wild-type and mutant proteins in E. coli

  • Measure absorption spectra to determine λmax shifts

  • Analyze the relationship between specific amino acid changes and spectral shifts

Machine Learning-Based Approach:
Machine learning models have successfully predicted rhodopsin spectral properties with mean absolute errors of approximately ±7.8 nm . This approach involves:

  • Build a dataset containing amino acid sequences and λmax values from known rhodopsins

  • Train a model focusing on key residues around the chromophore

  • Use the model to predict spectral effects of mutations

  • Experimentally verify high-confidence predictions

  • Refine the model with new data

One successful implementation calculated "expected red-shift gains" to identify mutations likely to red-shift absorption wavelengths. Using this ML-based approach, researchers identified rhodopsins with significant red-shift gains (82% of selected candidates showed actual red-shift) .

What techniques are available for phylogenetic analysis of Atherina boyeri rhodopsin compared to other fish species?

Phylogenetic analysis of Atherina boyeri rhodopsin can be conducted using multiple complementary approaches:

  • Multi-locus analysis: Combining rhodopsin (nuclear gene) with mitochondrial genes (cytochrome oxidase I, cytochrome b, and control region) provides more robust phylogenetic signal. This approach has been used to investigate genetic differentiation and relationships among Atherina boyeri populations .

  • Sequence alignment and tree-building methods:

    • Maximum likelihood

    • Bayesian inference

    • Maximum parsimony

    • Neighbor-joining

  • Population genetics analyses:

    • Haplotype network construction

    • Genetic distance calculations

    • FST and other differentiation metrics

A comprehensive study investigating Atherina boyeri combined 2180 base pairs from both mitochondrial and nuclear (rhodopsin) genes to resolve three distinct lineages in Greek populations . The rhodopsin gene specifically contributed to resolving relationships that mitochondrial genes alone could not detect.

How do mutations in rhodopsin affect protein function and phenotype expression?

Mutations in rhodopsin can significantly impact protein function through various mechanisms:

  • Protein folding disruption: Some mutations impair proper protein folding, leading to misfolded proteins that cannot function correctly .

  • Chromophore binding interference: Mutations can affect 11-cis-retinal binding, which is essential for rhodopsin function .

  • G-protein coupling/activation impairment: Certain mutations disrupt the ability of rhodopsin to interact with and activate G-proteins, affecting signal transduction .

  • Cellular trafficking problems: Some mutations interfere with the transport of rhodopsin to the proper cellular location .

The relationship between specific mutations and disease expression is considerable. For example, in retinitis pigmentosa patients, different rhodopsin mutations produce distinct clinical phenotypes:

Mutation TypeLocationPhenotype SeverityClinical Features
Missense mutations introducing/eliminating prolineTransmembrane domainsSevereRapid photoreceptor degeneration
Frameshift mutations (e.g., Arg314fs16)C-terminalMild ("mostly type 2")Slower progression, better visual field preservation
Missense mutations (e.g., Thr289Pro)TM VII near retinal binding siteSevereResembles unusually severe Lys296Glu phenotype

Mutations that disturb critical interhelical interactions, such as the Glu122, His211 salt bridge between TM III and TM V, result in a severe type of retinitis pigmentosa in vivo .

What are the most effective strategies for optimizing red-shifted variants of Atherina boyeri rhodopsin?

Developing red-shifted variants of Atherina boyeri rhodopsin would benefit from both knowledge-driven and data-driven approaches:

Knowledge-Driven Approach:
Based on understanding of the physicochemical principles of spectral tuning:

  • Target residues that affect retinal polyene chain distortion

  • Modify electrostatic interactions between protonated retinal Schiff base and counterion(s)

  • Alter the polarizability of the retinal binding pocket

Using these principles, several rhodopsins have been red-shifted by 20-40 nm without impairing ion-transport function .

Data-Driven Machine Learning Approach:

  • Build a database of rhodopsin sequences and their absorption wavelengths (λmax)

  • Train machine learning models to predict the expected red-shift gains

  • Consider the "exploration-exploitation trade-off" where:

    • Exploration: prefers candidates with larger predictive variances

    • Exploitation: prefers candidates with longer predictive mean wavelengths

This ML-based approach has demonstrated remarkable success, with 82% of selected candidates showing actual red-shift gains in experimental verification (p = 7.025 × 10⁻⁵), including four variants with red-shift gains >20 nm .

The most effective strategy would combine both approaches:

  • Use ML to identify promising candidates

  • Apply structural and mechanistic knowledge to refine predictions

  • Experimentally verify and characterize selected variants

  • Feed new data back into the ML model for continuous improvement

How can recombinant Atherina boyeri rhodopsin be adapted for optogenetic applications?

Adapting Atherina boyeri rhodopsin for optogenetics would focus on:

  • Spectral tuning for red-shifted variants:

    • Red-shifted rhodopsins allow deeper tissue penetration and reduced phototoxicity

    • Machine learning approaches can identify variants with significant red-shift gains (>20 nm)

    • Target the 24 key residues around the retinal chromophore that significantly influence absorption wavelength

  • Ion selectivity optimization:

    • Characterize the natural ion transport properties of Atherina boyeri rhodopsin

    • Modify key residues in the ion conduction pathway to alter selectivity

    • Test variants for specific ion transportation capabilities (protons, sodium, etc.)

  • Expression optimization in mammalian neurons:

    • Codon optimization for mammalian expression

    • Addition of trafficking signals to improve membrane localization

    • Fusion with fluorescent reporters to monitor expression and localization

  • Functional characterization:

    • Electrophysiological recordings to determine photocurrent magnitude and kinetics

    • Measure wavelength sensitivity and activation/deactivation kinetics

    • Test in various neuronal subtypes to assess broad applicability

Machine learning approaches have already identified rhodopsin variants with desirable ion-transporting properties that would be potentially useful in optogenetics . These methods could be applied specifically to Atherina boyeri rhodopsin to develop variants optimized for different optogenetic applications.

What are common challenges in recombinant rhodopsin expression and how can they be addressed?

Common Challenges and Solutions:

  • Low protein expression levels:

    • Optimize codon usage for the expression system

    • Test different promoters and expression vectors

    • Adjust induction conditions (temperature, inducer concentration, induction time)

    • Use specialized E. coli strains designed for membrane protein expression

  • Protein misfolding/aggregation:

    • Express at lower temperatures (16-20°C)

    • Use molecular chaperones as co-expression partners

    • Add stabilizing agents to the growth medium

    • Optimize all-trans retinal concentration (typically 10 μM has been effective)

  • Improper chromophore incorporation:

    • Ensure adequate all-trans retinal availability during expression

    • Protect from light during expression and purification

    • Optimize the timing of retinal addition

  • Difficulties in functional characterization:

    • For absorption spectra measurement, use hydroxylamine bleaching to confirm specific rhodopsin absorbance

    • For ion pumping activity, develop appropriate functional assays

In one study, researchers synthesized 65 rhodopsin genes, but only 39 E. coli cells showed substantial coloring (indicating successful protein expression) . This highlights the variable success rate in rhodopsin expression and the need for optimization strategies.

How can I analyze spectral data from mutant variants to identify structure-function relationships?

Analysis of spectral data from rhodopsin variants requires systematic approaches:

  • Baseline data collection:

    • Measure wild-type Atherina boyeri rhodopsin λmax as reference

    • Record complete absorption spectra (not just peak maxima)

    • Document experimental conditions precisely for reproducibility

  • Comparative analysis framework:

    • Calculate "red-shift gains" relative to the base wavelength

    • Use statistical methods to determine significance of observed shifts

    • Group mutations by location within protein structure

  • Structure-function correlation:

    • Map mutations onto 3D structural models

    • Identify patterns among mutations with similar spectral effects

    • Use molecular dynamics simulations to understand conformational changes

  • Machine learning approaches:

    • Train ML models on existing spectral data

    • Identify which amino acid positions most strongly influence λmax

    • Use Bayesian modeling to compute predictive distributions of rhodopsin red-shift gains

One successful approach used predictive distributions to consider the "exploration-exploitation trade-off" in screening processes, where exploration indicates preference for candidates with larger predictive variances, and exploitation indicates preference for candidates with longer predictive mean wavelengths .

What statistical methods are most appropriate for analyzing phylogenetic data from Atherina boyeri rhodopsin sequences?

For robust phylogenetic analysis of Atherina boyeri rhodopsin sequences:

  • Sequence alignment quality assessment:

    • Use multiple alignment algorithms and compare results

    • Manually inspect and refine alignments, particularly around gaps

    • Consider structural information when aligning transmembrane regions

  • Model selection:

    • Test multiple evolutionary models (JTT, WAG, LG for protein sequences)

    • Use Akaike Information Criterion (AIC) or Bayesian Information Criterion (BIC) for model selection

    • Consider gamma-distributed rate variation among sites

  • Tree-building methods comparison:

    • Maximum likelihood with bootstrap support

    • Bayesian inference with posterior probabilities

    • Maximum parsimony and distance-based methods as complementary approaches

  • Hypothesis testing:

    • Shimodaira-Hasegawa (SH) test or Approximately Unbiased (AU) test to compare alternative tree topologies

    • Likelihood ratio tests for specific evolutionary hypotheses

  • Population genetics analyses:

    • Calculation of genetic diversity indices

    • Tests for selection (dN/dS ratios)

    • Analysis of genetic differentiation between populations

Previous research on Atherina boyeri has shown that combining nuclear (rhodopsin) and mitochondrial genes provides more robust phylogenetic results than either alone. This multi-locus approach revealed three distinct lineages in Greece, with clear differentiation between lagoon and marine forms .

How might genomic approaches enhance our understanding of rhodopsin evolution in Atherina boyeri?

Genomic approaches offer powerful new avenues for understanding rhodopsin evolution:

  • Whole genome sequencing:

    • Identify additional opsin genes in the Atherina boyeri genome

    • Examine synteny and genomic context of the rhodopsin gene

    • Detect regulatory elements controlling rhodopsin expression

  • Comparative genomics:

    • Compare opsin gene repertoires across closely related fish species

    • Identify lineage-specific duplications or losses

    • Examine selection patterns across the entire gene family

  • Population genomics:

    • Sequence rhodopsin genes from diverse Atherina boyeri populations

    • Correlate genetic variation with environmental factors (water clarity, depth, salinity)

    • Test for signatures of selection or local adaptation

  • Functional genomics:

    • RNA-seq analysis to examine rhodopsin expression patterns

    • Identify co-expressed genes involved in phototransduction

    • CRISPR-Cas9 gene editing to study rhodopsin function in vivo

Previous research has already shown distinct lineages within Atherina boyeri populations in Greece, with clear differentiation between Aegean and Ionian Sea populations in the lagoon form . Genomic approaches could further refine our understanding of how visual adaptation has contributed to this diversification.

What potential exists for developing specialized machine learning tools for rhodopsin research?

Machine learning approaches show tremendous promise for rhodopsin research:

  • Specialized prediction models:

    • Absorption wavelength (λmax) prediction with improved accuracy

    • Ion selectivity and transport efficiency prediction

    • Protein expression level and stability prediction

  • Integration of structural information:

    • Incorporate 3D structural features into ML models

    • Predict effects of mutations on protein dynamics

    • Model chromophore-protein interactions

  • Automated experimental design:

    • ML-based experimental design for optimal mutation screening

    • Balance between exploration (novel mutations) and exploitation (promising candidates)

    • Continuous learning from experimental results

  • Multi-property optimization:

    • Simultaneously optimize multiple rhodopsin properties (λmax, photocycle kinetics, ion selectivity)

    • Identify optimal variants for specific applications

    • Design minimal mutation sets for desired property changes

One successful implementation used a Bayesian modeling framework to compute predictive distributions of candidate rhodopsin red-shift gains. This approach considered the exploration-exploitation trade-off by selecting candidate rhodopsins based on "expected red-shift gains" and successfully identified numerous red-shifted variants (82% success rate, p = 7.025 × 10⁻⁵) .

How might advances in structural biology techniques impact research on Atherina boyeri rhodopsin?

Emerging structural biology techniques will revolutionize Atherina boyeri rhodopsin research:

  • Cryo-electron microscopy (cryo-EM):

    • Determine high-resolution structures without crystallization

    • Capture rhodopsin in multiple conformational states

    • Visualize rhodopsin-transducer complexes

  • X-ray free-electron lasers (XFELs):

    • Conduct time-resolved structural studies

    • Capture intermediate states during photocycle

    • Understand dynamic structural changes upon light activation

  • Integrative structural approaches:

    • Combine cryo-EM, X-ray crystallography, and NMR data

    • Incorporate molecular dynamics simulations

    • Develop comprehensive structural models

  • In situ structural determination:

    • Study rhodopsin structure in native-like membrane environments

    • Examine effects of lipid composition on rhodopsin structure and function

    • Understand protein-protein interactions in native context

These advances will provide unprecedented insights into:

  • Precise mechanisms of spectral tuning in Atherina boyeri rhodopsin

  • Structural basis for species-specific adaptations

  • Conformational changes during photoactivation

  • Structure-function relationships underlying ion transport

Understanding these structural details will inform both evolutionary studies and applied research for optogenetics applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.