Recombinant ATP-dependent zinc metalloprotease YME1 homolog (ymel-1)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant ATP-dependent zinc metalloprotease YME1 homolog (ymel-1) is an ATP-dependent metalloprotease that degrades folded and unfolded proteins that contain a specific degron sequence . YME1L1 (YME1 Like 1 ATPase) is a protein-coding gene in humans . Diseases associated with YME1L1 include Optic Atrophy 11 and Autosomal Recessive Isolated Optic Atrophy .

Expression and Purification

Recombinant ATP-dependent zinc metalloprotease YME1 homolog (ymel-1) can be expressed and purified from different hosts . E. coli and yeast offer the best yields and shorter turnaround times . Expression in insect or mammalian cells can provide posttranslational modifications necessary for correct protein folding or retain the protein's activity .

Function and Significance

YME1L, a mitochondrial protease, maintains pyrimidine pools by supporting de novo nucleotide synthesis and through proteolysis of the pyrimidine nucleotide carrier SLC25A33 .

Role in Immune Response

YME1L has an anti-inflammatory role and prevents mitochondrial DNA release from mitochondria . Deficiency of YME1L causes inflammation in mouse retinas and cultured cells, driving the release of mitochondrial DNA and a cGAS–STING–TBK1-dependent inflammatory response, which requires SLC25A33 and is suppressed upon replenishment of cellular pyrimidine pools .

Impact on Mitochondrial Proteome

Studies show that YME1L influences the mitochondrial proteome and the accumulation of mitochondrial proteins, including YME1L substrate proteins . Several of these proteins are associated with mitochondrial DNA metabolism, such as the pyrimidine nucleotide carrier SLC25A33 and components of the mitochondrial nucleoside salvage pathway, like cytidine/uridine monophosphate kinase 2 (CMPK2) and nucleoside diphosphate kinase NME4 .

Involvement in Nucleotide Metabolism

YME1L is essential for efficient glutaminolysis and de novo nucleotide synthesis in the cytosol, and it regulates the uptake of pyrimidine nucleotides into mitochondria . Loss of YME1L reduces cell growth, as shown in cell proliferation experiments .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
ymel-1; M03C11.5; ATP-dependent zinc metalloprotease YME1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-723
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
ymel-1
Target Protein Sequence
MQSAINLNIGGLLQNTGLLRNSRNGINRKPLDIEATAASLSRVYHQVWRQFSSDTSSPVT INQMNNILRDSTLSRRIARKSEISLNYDDAVVRIIPASSSFYIQRRGFRTRKQTFGVGNA GKPTQDEVKSPLTYFSELLAGKKQKTSEGGVEKWNQYESDLKKLPENQQRTYTDGFVKGL LSNGVSGAGKDGKKSNTLTRFYIFLVFCIFFGYLTGRIRVRVGDRQIGSLFFSNPQEVNP EDVQVTFDDVRGMDEAKLEVEEIVDYLKDPEKYSRLGGRLPKGVLLVGPPGTGKTLLARA IAGEAQVPFFHTAGSEFDEVLVGQGARRVRDLFDKAKARAPCIIFIDEIDSVGSKRVSNS IHPYANQTINQLLSEMDGFTRNEGIIVIAATNRVDDLDKALLRPGRFDVRVTVPKPDLAG RVDIFNFYLSKIVHSGGIDPKVLAKGSTGFTGADIENMVNQAALKAATDNAVEVTMAYLD EARDRVLMGPARTGGRIPDEEANRNTAYHEAGHTLVSLYTKDATPLHKVTIIPRGQSLGH TAMLPEKDSYQLTKAQMLATLDVMMGGRVAEELIFGDDKVTTGAADDLSKATQLAVQMVK VFGMSDKVGLRDFTAQDNESALVKVSDLAPQTAELIDAEINRVLQESYKRAKVILETKKK EHQLLAEALLEYETLSADEVKRVISGQKIKRPTPAAVKKSNETKRNQPSLVLHLFEEEGR GKQ
Uniprot No.

Target Background

Function

Recombinant ATP-dependent zinc metalloprotease YME1 homolog (ymel-1) is an ATP-dependent metalloprotease that catalyzes the degradation of folded and unfolded proteins containing appropriate degron sequences within the mitochondrial intermembrane space. It plays a critical role in regulating mitochondrial morphology and function.

Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Mitochondrion inner membrane. Mitochondrion.

Q&A

What is the basic structure and function of YME1?

YME1 is an ATP-dependent metalloprotease that belongs to the peptidase M41 family in its C-terminal section. It catalyzes the degradation of both folded and unfolded proteins containing suitable degron sequences in the mitochondrial intermembrane region. The protein plays a critical role in regulating mitochondrial morphology and function . Structurally, YME1 forms a homo-oligomeric complex within the inner mitochondrial membrane, with its protease domain facing the intermembrane space (termed i-AAA protease) . The Caenorhabditis elegans YME1 homolog consists of 723 amino acids with a molecular mass of approximately 79.8 kDa .

What are the conserved functional domains in YME1?

YME1 contains two highly conserved sequence elements that are essential for its function:

  • An ATPase domain implicated in the binding and hydrolysis of ATP

  • A zinc-dependent protease domain with characteristic active site residues

Mutations in critical residues of either of these motifs eliminate the function of YME1, demonstrating that both the ATPase and proteolytic activities are necessary for proper function . The sequence of C. elegans YME1 reveals multiple functional regions including ATPase domains, transmembrane regions, and the protease domain .

Which expression systems are optimal for recombinant YME1 production?

Recombinant ATP-dependent zinc metalloprotease YME1 homolog can be expressed in multiple host systems with varying advantages:

Expression SystemAdvantagesDisadvantagesTypical Yield
E. coliHigh yield, rapid production, cost-effectiveLimited post-translational modificationsHigh
YeastProper folding, some post-translational modificationsModerate yieldMedium-High
Insect cellsBetter post-translational modifications, enhanced foldingLonger production time, higher costMedium
Mammalian cellsFull range of post-translational modifications, highest activityLowest yield, highest cost, complex protocolsLow

E. coli and yeast systems offer the best yields with shorter turnaround times, while expression in insect cells with baculovirus or mammalian cells can provide many of the post-translational modifications necessary for correct protein folding and retention of activity .

What purification strategy yields functional YME1 protein?

A standard purification protocol for YME1 typically involves:

  • Cell lysis under conditions that preserve proteolytic activity (often with non-ionic detergents)

  • Initial capture using affinity chromatography (if tagged versions are used)

  • Ion exchange chromatography to remove contaminants

  • Size exclusion chromatography to isolate properly assembled oligomeric complexes

Critical considerations include maintaining the presence of zinc ions throughout purification and including ATP or non-hydrolyzable ATP analogs to stabilize the protein. For studying YME1 complexes, mild detergents such as digitonin or DDM are preferable to preserve protein-protein interactions .

How can researchers verify proper folding and activity of purified YME1?

Verification of proper folding and activity should include:

  • Size exclusion chromatography to confirm oligomeric state (YME1 forms homo-oligomeric complexes)

  • Circular dichroism spectroscopy to assess secondary structure

  • Proteolytic activity assays using known substrates (such as unassembled cytochrome oxidase subunit II)

  • ATPase activity measurements to confirm ATP hydrolysis capability

  • Blue Native-PAGE to assess complex integrity and proper assembly

Researchers should assess both the ATPase and proteolytic activities since both are essential for YME1 function .

What methods are available to identify YME1 substrates?

Several approaches have proven effective for identifying YME1 substrates:

  • Comparative proteomics: Compare mitochondrial proteome from wild-type and YME1-deficient cells to identify proteins that accumulate in the absence of YME1

  • Co-immunoprecipitation with catalytically inactive mutants: Mutations like E541Q in yeast YME1 trap substrates that can be identified by mass spectrometry

  • Pulse-chase assays: Monitor degradation kinetics of radiolabeled candidate proteins

  • In vitro degradation assays: Test purified candidate proteins with recombinant YME1

  • Genetic interaction screens: Identify genetic interactions that suggest functional relationships

Studies have identified several YME1 substrates including subunits of the electron transport chain like Cox2 and Cox4, small Tim protein Tim10, and mitophagy receptor Atg32 .

How can researchers measure YME1 proteolytic activity in vitro?

A robust in vitro proteolytic activity assay for YME1 typically includes:

  • Purified recombinant YME1 or immunoprecipitated YME1 complex

  • Known substrate protein or fluorogenic peptide substrate

  • Reaction buffer containing:

    • ATP (1-5 mM)

    • MgCl₂ (5-10 mM)

    • ZnCl₂ (0.1-1 mM)

    • Salt (50-150 mM NaCl)

    • Buffer (typically HEPES pH 7.4)

  • Incubation at 30°C (yeast YME1) or 37°C (mammalian YME1L1)

  • Analysis by SDS-PAGE, western blotting, or fluorescence measurement

Control reactions should include ATP-depleted conditions, catalytically inactive YME1 mutants, and metal chelators to confirm ATP-dependence and metalloprotease activity .

How should researchers design experimental controls when studying YME1 function?

Appropriate controls for YME1 functional studies include:

  • Catalytically inactive mutants:

    • E541Q mutation in the protease domain (maintains substrate binding but abolishes proteolysis)

    • K327R mutation in the ATPase domain (impairs ATP hydrolysis)

  • Adapter protein deletions:

    • Mgr1Δ and Mgr3Δ strains (impair substrate recruitment without affecting YME1 expression)

  • Domain truncations:

    • IMS domain truncations can be used to study domain-specific functions

  • Complementation controls:

    • Wild-type YME1 expression in YME1-deficient cells should rescue phenotypes

    • Human YME1L1 can complement yeast yme1Δ in some assays

Each experiment should include both positive controls (known substrates) and negative controls (non-substrate proteins like Por1) .

How do YME1 homologs differ across species?

YME1 homologs show both conservation and divergence across species:

SpeciesHomolog NameSizeKey DifferencesNotable Functions
S. cerevisiaeYme1~80 kDaForms complex with Mgr1/Mgr3mtDNA escape control, respiratory growth
C. elegansYMEL-1723 aa, 79.8 kDaLess characterizedMitochondrial morphology regulation
H. sapiensYME1L1~80 kDaProcesses OPA1Critical for mitochondrial fusion, optic nerve integrity

In humans, YME1L1 was first identified as a homolog of yeast YME1, which was discovered in a screen for gene products that elevate the rate of mitochondrial DNA migration to the nucleus . Unlike yeast YME1, human YME1L1 has a specific role in processing OPA1, a key regulator of mitochondrial fusion and fission, making it critical for maintaining mitochondrial network dynamics .

Can findings from yeast YME1 be directly translated to mammalian systems?

While many functions are conserved between yeast and mammalian YME1 homologs, researchers should consider important differences:

  • YME1L1 in humans has evolved specific substrates and functions not present in yeast, particularly OPA1 processing

  • The human YME1L1 complex may have different adapter proteins than the yeast Mgr1/Mgr3 system

  • Mitochondrial import and processing mechanisms show subtle differences

  • Regulatory mechanisms may differ significantly

How do mutations in different YME1 homologs affect organismal phenotypes?

YME1 mutations produce distinctive phenotypes across species:

  • Yeast (S. cerevisiae):

    • yme1Δ strains show temperature-sensitive growth on non-fermentable carbon sources

    • Increased mtDNA escape to the nucleus

    • Altered mitochondrial morphology

    • Surprisingly, some studies show increased chronological lifespan in yme1Δ mutants

  • Worms (C. elegans):

    • Less well-characterized but involved in mitochondrial proteostasis

  • Humans:

    • Homozygous missense mutation in YME1L1 (R149W) causes mitochondriopathy

    • Symptoms include infantile-onset developmental delay, muscle weakness, ataxia, and optic nerve atrophy

    • Mutations lead to mitochondrial fragmentation due to impaired OPA1 processing

These phenotypic differences highlight the expanded roles of YME1 homologs in higher organisms, particularly in tissues with high energy demands like neurons and muscles .

How does YME1 assemble into functional complexes?

YME1 assembles into a homo-oligomeric complex within the inner mitochondrial membrane. In yeast, blue-native PAGE analysis has revealed two YME1-containing complexes: a major complex <1,048 kD and a minor complex >1,236 kD . This complex assembly is critical for function, as it creates a central pore through which substrates are threaded for degradation.

The YME1 complex in yeast incorporates two adapter proteins:

  • Mgr1 - Bridges the interaction between Yme1 and Mgr3

  • Mgr3 - Stabilizes Mgr1 but is not required for Mgr1-Yme1 interaction

These adapter proteins form a subcomplex even in the absence of Yme1, and both are required for optimal substrate recruitment and degradation . The assembly process likely begins with membrane insertion of individual YME1 monomers, followed by oligomerization and association with adapter proteins.

What techniques are most effective for studying YME1 complex assembly?

Researchers studying YME1 complex assembly can employ several key techniques:

  • Blue Native-PAGE: Resolves native complexes while preserving their interactions; has successfully identified two distinct YME1 complexes in yeast

  • Sucrose gradient centrifugation: Can separate complexes based on size and has been used to demonstrate that even precursor forms of mutant YME1L1 can assemble into large complexes

  • Co-immunoprecipitation: Identifies interaction partners; critical for establishing the relationship between YME1 and adapter proteins like Mgr1 and Mgr3

  • Crosslinking coupled with mass spectrometry: Identifies direct contact points between subunits

  • Electron microscopy/Cryo-EM: Provides structural insights into complex organization

Each technique provides complementary information about complex assembly and structure, allowing for a comprehensive understanding of how YME1 functions within its native environment.

How do adapter proteins affect YME1 substrate specificity and function?

Adapter proteins play critical roles in YME1 substrate recognition and degradation:

  • Substrate recruitment: Both Mgr1 and Mgr3 are required for optimal substrate recruitment to YME1. Their deletion greatly reduces the interaction between YME1 and substrates like Tom22-HA and Om45-HA .

  • Substrate specificity: Adapter proteins likely confer substrate specificity by recognizing specific features or degrons in target proteins. The IMS domain of substrates appears critical for recognition, as demonstrated by chimeric protein studies .

  • Complex stability: Interestingly, Mgr3 is required to stabilize Mgr1, as Mgr1 becomes a YME1 substrate itself in the absence of Mgr3. This regulatory mechanism might fine-tune YME1 activity .

  • Functional redundancy: Mgr1 alone can facilitate substrate recruitment to some extent, but both adapters are required for optimal function. This suggests partial functional redundancy between adapter proteins .

The working model suggests that in the YME1-Mgr1-Mgr3 complex, Mgr1 bridges complex formation between YME1 and Mgr3, while Mgr3 stabilizes Mgr1 but is not required for Mgr1 interaction with YME1 .

What diseases are associated with YME1 dysfunction in humans?

Mutations in YME1L1, the human homolog of YME1, have been associated with a mitochondriopathy characterized by:

  • Infantile-onset developmental delay

  • Muscle weakness

  • Ataxia

  • Optic nerve atrophy

This condition was first identified in a consanguineous pedigree of Saudi Arabian descent with a homozygous missense mutation (R149W) in YME1L1 . This mutation occurs in a highly conserved region in the mitochondrial pre-sequence and inhibits proper processing of YME1L1 by the mitochondrial processing peptidase (MPP) .

Additionally, YME1L1 dysfunction has been implicated in:

  • Optic atrophy disorders

  • Mitochondrial dynamics disorders

  • Neurodegeneration

The disease manifestations primarily affect high-energy consuming organs, consistent with YME1L1's critical role in mitochondrial function and quality control .

What are the molecular mechanisms underlying YME1L1-associated pathologies?

The R149W mutation in YME1L1 causes disease through several mechanisms:

  • Impaired protein processing: The mutation prevents proper cleavage of the mitochondrial targeting sequence by MPP, as arginine 149 forms part of the MPP recognition and cleavage site .

  • Protein instability: Unprocessed YME1L1 precursor is rapidly degraded, leading to severely reduced YME1L1 protein levels despite normal mRNA expression .

  • Auto-catalytic degradation: Evidence suggests that mutant YME1L1 precursor undergoes auto-catalytic degradation. When the catalytically inactive mutation E381Q is combined with R149W, the precursor form accumulates, supporting this mechanism .

  • Disrupted mitochondrial dynamics: Patient fibroblasts show increased mitochondrial fragmentation due to abnormal processing of OPA1, a key regulator of mitochondrial fusion .

  • Residual activity: The R149W mutant retains partial proteolytic activity and can still oligomerize, explaining why it results in a milder phenotype than complete gene knockout, which is embryonically lethal in mice .

How do YME1 mutations affect mitochondrial function and cellular health?

YME1 mutations have profound effects on mitochondrial function and cellular health:

How does YME1 coordinate with other mitochondrial quality control systems?

YME1 functions within an integrated network of mitochondrial quality control mechanisms:

  • Crosstalk with the carrier translocase machinery: Recent research has uncovered a novel genetic connection between the TIM22 complex and YME1 machinery in maintaining mitochondrial proteostasis. Impairment in the TIM22 complex can rescue respiratory growth defects of cells lacking YME1, suggesting that excessive levels of TIM22 pathway substrates may contribute to defects in YME1-deficient cells .

  • Coordination with other proteases: YME1 works in concert with other mitochondrial proteases including Lon1 and Yta12. Interestingly, while yme1Δ mutants show increased longevity, lon1Δ and yta12Δ mutants display reduced lifespan, indicating distinct but interconnected roles in mitochondrial protein quality control .

  • Integration with mitochondrial dynamics: YME1L1 in humans directly processes OPA1, linking protein quality control to mitochondrial fusion-fission dynamics. Studies have found that deletion of fission genes (dnm1 or fis1) increases longevity, suggesting complex interplay between these systems .

  • Compensatory mechanisms: When YME1 is absent, other quality control mechanisms may be upregulated, including mitophagy, ubiquitin-proteasome degradation of mitochondrial proteins, or alternative proteolytic pathways .

Future research should focus on mapping these interconnections to develop a comprehensive understanding of mitochondrial proteostasis networks.

What methodological approaches can resolve contradictory findings about YME1 function?

Some experimental findings regarding YME1 function appear contradictory, such as increased lifespan in some yme1Δ models despite impaired mitochondrial function. Researchers can address these contradictions through:

  • Context-dependent analysis: Carefully controlling growth conditions, genetic background, and metabolic state when comparing results across studies. For example, the enhanced longevity of yme1Δ cells is observed primarily in specific media conditions .

  • Integrated multi-omics approaches: Combining proteomics, metabolomics, and transcriptomics to gain a comprehensive view of cellular adaptations to YME1 loss.

  • Temporal analysis: Examining acute versus chronic effects of YME1 loss, as compensatory mechanisms may develop over time.

  • Tissue-specific and organism-specific considerations: Recognizing that YME1 functions may vary across tissues and organisms, explaining why findings in yeast may not directly translate to mammalian systems.

  • Careful genetic engineering: Using precise genetic editing techniques to create equivalent mutations across model systems for accurate comparison.

  • Quantitative approaches: Developing quantitative assays for YME1 activity that can measure partial loss of function rather than just complete deletion phenotypes.

These approaches can help reconcile seemingly contradictory findings and develop a more nuanced understanding of YME1 function in different contexts.

What are emerging technologies for studying YME1 function in complex biological systems?

Cutting-edge technologies are expanding our ability to study YME1 in sophisticated biological contexts:

  • Proximity labeling proteomics: BioID or APEX2 fused to YME1 can identify the local proteome and transient interaction partners in living cells.

  • Single-cell analyses: Examining YME1 function in heterogeneous cell populations to understand cell-to-cell variability in mitochondrial quality control.

  • Live-cell imaging of substrate degradation: Using fluorescent timers or photoconvertible proteins fused to YME1 substrates to monitor degradation kinetics in real-time.

  • Organoid and patient-derived cell models: Studying YME1L1 mutations in more physiologically relevant contexts, including 3D organoids.

  • CRISPR-based screening: Identifying genetic modifiers that enhance or suppress YME1-related phenotypes through genome-wide screens.

  • Structural biology advances: Cryo-EM studies of the complete YME1 complex with substrates and adapters to understand the molecular mechanisms of substrate recognition and processing.

  • Mitochondrial in organello translation systems: Developing methods to study how YME1 affects mitochondrial protein synthesis and assembly in isolated mitochondria.

These emerging technologies will allow researchers to address more sophisticated questions about YME1 function in both normal physiology and disease states.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.